KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2758Help
Entry
Lferr_2758        CDS       T00758                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_3 FR47 Acetyltransf_CG Acetyltransf_8 Acetyltransf_4 Acetyltransf_6 DUF3749 Acetyltransf_9
Motif
Other DBs
NCBI-ProteinID: ACH84949
UniProt: B5EQZ8
Position
complement(2743901..2744386)
Genome map
AA seq 161 aa AA seqDB search
MPLTHRPVDEKDIQIICGFPQSEDELFFLFPKAEFPLSSSQLRDAIAQRSDSSVVELGGE
VIAFANFYRWESGGRCSIGNVIVSPAARGRGVGRYLIEQMIALAFSKHQAAEIIVSCFNQ
NIAGLLFYQKLGFQPYAIEERQGRKGNRIALIHLRLSRNAT
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgacgcatcgccccgttgacgagaaagacattcaaatcatttgcgggtttcca
caaagtgaagacgaactatttttcttgttcccaaaggcggaattcccgttgtcttcttcg
caattacgggatgccatagcgcagcgttcagattcatccgtagtcgagcttggtggtgaa
gtcattgcttttgccaatttctatcgctgggagtctggcggccgttgctccatcggcaat
gtcatcgtttccccggcggcccgtgggcgcggggtgggccgctatctcatcgaacagatg
attgcccttgctttttcaaagcatcaggcggccgagataatagtgtcgtgtttcaatcaa
aatattgccggtttactgttttatcagaagctgggatttcaaccttacgccattgaggag
cggcagggcaggaaaggaaatcggattgcgcttattcacctacggctatcgagaaatgcg
acctga

DBGET integrated database retrieval system