KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2760Help
Entry
Lferr_2760        CDS       T00758                                 

Definition
(GenBank) ABC transporter related
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_23 AAA_30 RsgA_GTPase NACHT AAA_16 Rad17
Motif
Other DBs
NCBI-ProteinID: ACH84951
UniProt: B5ER00
Position
complement(2744840..2745487)
Genome map
AA seq 215 aa AA seqDB search
MLRFEGITKSFGWRRIFQDIRGELVPGVYALQGPNGSGKSTLLGILSGAIAADAGEVWIN
DVSLQTAPLPARQGLSYAPDESPIYPFMTGRDLLDFVAMAKKTRVGPDILELIAQFGLDP
HLQTRFSAMSLGTQKKFMLSAAWIGDPQVMLLDEPSNGLDNHAREILAQCIRLRGLEGLA
LFASHDAAFVEACGANILRMEHLKSPEHCLALVRV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgattcgaggggatcaccaagtcctttggctggcgccggattttccaggacatc
cgtggcgaactggttccaggcgtttatgccctgcaggggccgaacggcagcggtaagtcc
acgctgctgggcatcctgtcaggggccattgcggctgacgcgggcgaggtctggataaat
gacgtcagcctccagacggcaccgttgcccgcgcggcaagggctgtcctacgcgcctgat
gaaagccctatctatcctttcatgactgggcgtgacctgctggatttcgtcgccatggcc
aaaaagaccagggtcggtccggatattctggaattgatcgcccaattcggactggacccg
cacctgcagacccgtttcagtgccatgtcgctgggcacacagaaaaaattcatgctcagc
gcggcctggatcggcgacccgcaggtgatgctgctggatgagccgagcaatggattggac
aatcatgcccgagaaatcttagcccagtgcatcaggttacgtggtctggaggggttggcg
ctgtttgcgagccatgacgctgcgttcgtggaagcttgcggggccaatatcttgcggatg
gagcacctgaaatcccctgagcattgtctggcgttagtccgagtataa

DBGET integrated database retrieval system