KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2769Help
Entry
Lferr_2769        CDS       T00758                                 

Definition
(GenBank) hypothetical protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN_2 PIN_3
Motif
Other DBs
NCBI-ProteinID: ACH84960
UniProt: B5ER09
Position
complement(2750742..2751167)
Genome map
AA seq 141 aa AA seqDB search
MPRRRLVVDANILIRAVLGLRVRLLIADACDRVSFYVAEANYDEAKHYLAELAPARGISE
VVWQDALDTLMTAIQLIGQETLSPVEIAAKARIARRDERDWPAVAASLLLDCPIWTEDRD
FFGAGVATWTTETISIYLDSC
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtaggcggttggttgtagacgccaacatcctgattcgtgctgtcttggggctg
cgagtacgattgctcatcgccgatgcatgtgacagggtcagtttctatgtggccgaagca
aattatgacgaagccaagcactacttagcagaattggctcccgcccggggaatatccgaa
gtggtgtggcaggacgcgttagatacgcttatgacggccatacagttgattggccaggaa
acattgtcgcctgtagaaattgccgcaaaagccagaattgcccggagagacgaacgggat
tggccggcggtagcggcgtccctgctgctggattgtccgatctggacggaggatcgagat
ttctttggtgccggtgtggcaacctggacgacagaaaccatatctatatatcttgatagc
tgctga

DBGET integrated database retrieval system