KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2773Help
Entry
Lferr_2773        CDS       T00758                                 

Definition
(GenBank) hypothetical protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4338 DDE_Tnp_1_assoc Herpes_BLRF2
Motif
Other DBs
NCBI-ProteinID: ACH84964
UniProt: B5EK20
Position
complement(2753576..2754895)
Genome map
AA seq 439 aa AA seqDB search
MEASTLTSHQQASLHRIEVRPILPTERERWNTLMQAHHYRGFRTMAGRTLRYVATLDDRW
VALLGWQAAAYQCQAREQWIGWSWVLRRQRLHLIANNARFLILPRESFPNLASRILSLNL
RRLSADWQSVYGHPIVLAETFVESPRFTGACYRAANWVDVGWTKGFARRPGAGYVYHGQP
KRLLLYPLHPQARIWLAQPQPQSEWTKTPMQTVTLSDAQMEGLRQIFFRLPDARSRLGKQ
HPLPAILTIAVAAVLTQAQSYIAMAEWAARLTQAQLKRIRARFNPRTQRYVAPSEPTLRR
VLQGANVTALDAAIGAWLLGIAGFEAVAVDGKVLKGAVREDGSQVHLLSAFMHGQGATIA
QKEIARKTNEIPELRSLLKDVDIQDKVVTADALHTQRKTARFLVEDKKADYLFTAVKGNQ
RKLRNSLICLPWGDFPPQR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctcaacgctcacatcacatcagcaagccagcctgcaccgtattgaggtgcgg
cccatcctgcccacagagcgggaacgctggaataccctgatgcaagcgcatcattatcgc
ggcttccgcacaatggcgggacgcaccctgcgctacgtggccacgctggatgaccgctgg
gtagcgctcctcggctggcaggccgccgcttaccagtgtcaggcgcgggagcagtggatc
ggctggtcctgggtcttgcgccgccagcgcctgcacctcatcgccaataatgcccgcttt
ctgatcctgccgagggagtcctttcccaacctggcttcccgtattctttccctgaacctc
cgccgactttctgctgactggcagtcggtctacggtcaccccatcgtgctggccgagacc
ttcgtggaatcgcctcgttttactggcgcctgctaccgggccgcaaactgggtggacgtc
ggctggaccaagggctttgcccgccgtcccggcgcaggctatgtctaccacggtcagccc
aaacggcttctgctctatccccttcacccccaggcgcgtatctggcttgcccagccgcag
ccacaatccgaatggacgaaaacccctatgcaaaccgtcaccctgagcgatgcgcaaatg
gaaggcttgcgccaaattttctttcgcctgcccgatgcccgcagccgtctgggcaagcag
catcctctcccggccattctgaccatagccgtggccgccgtcctcacccaggcccaaagc
tatatcgcgatggccgagtgggccgcccggctgacccaagcgcaactgaagcgtatccgc
gcccgattcaatcccaggacgcaacgctatgtggcgccttccgaaccgaccctgcgtcgc
gtcctgcaaggcgccaacgtcacggcactggatgccgctatcggtgcctggctgctgggt
atcgccggatttgaagccgtggctgtcgatggcaaagtgctcaaaggcgcggttcgggaa
gatgggtcccaggtccatctcctcagcgctttcatgcacggccagggagccaccattgca
caaaaagaaatcgcccggaaaaccaacgaaatcccggagctgcgcagcctgctcaaagac
gtcgacatccaggacaaggtcgtcaccgccgatgctctgcatacccagcgaaagaccgct
cgattcctcgttgaagacaaaaaggccgattatctcttcaccgccgtcaaaggcaatcag
cgaaaactccgcaacagcctgatatgcctcccttggggcgatttcccccctcagcgctga

DBGET integrated database retrieval system