KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2777Help
Entry
Lferr_2777        CDS       T00758                                 

Definition
(GenBank) conserved hypothetical protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACH84968
UniProt: B5ER17
Position
2758359..2758643
Genome map
AA seq 94 aa AA seqDB search
MLLPHMRGSRKFALTGPLTVNDPEGIQVILNFMNYLWSGGREPARIYLQRTSLPVILTMA
ANGTYAKAMQSCEEMESLAEHMVEQWDRSANMDW
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
gtgctcttgcctcacatgcggggatcgcgaaagttcgcccttacaggcccgctcactgtg
aatgatcctgaaggcattcaagtgatcctaaattttatgaactatctgtggagtggtggg
cgtgaacccgcaagaatttaccttcagcgaaccagcttgccggttattttgaccatggcc
gccaatggcacatatgccaaagccatgcaatcatgtgaagagatggaaagcttggcggag
cacatggtggaacagtgggatcgatcggcgaacatggactggtaa

DBGET integrated database retrieval system