KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2781Help
Entry
Lferr_2781        CDS       T00758                                 

Definition
(GenBank) transposase IS116/IS110/IS902 family protein
  KO
K07486  transposase
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
KEGG Orthology (KO) [BR:afe00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Lferr_2781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transposase_20 DEDD_Tnp_IS110 Glyco_transf_4 DivIC
Motif
Other DBs
NCBI-ProteinID: ACH84970
UniProt: B5EJB7
Position
complement(2760167..2761195)
Genome map
AA seq 342 aa AA seqDB search
MQVTTYGLDLAKRVMQLHWVNLETGEIHRKQLKRRALLEFFANRQPGIVAMEACGSAHYW
GRELRKLGHEVRLIAAQFVRPFVKTNKNDAADAAAIWEAVQRPDMRFVAVKSEEQQSVLS
LHRMREQLIKMRTMQVNQIRGLLYEFGADLPQGRQRGLKEVPDALADLEKSISPMLRDTV
RQQLKRLEEMDKDIADIEKRLTLWKKGQEAVTRLMAIPGVGLLTATAIIATVGDMKSFRS
GREFAAFLGLVPRQSGTGGKVRLLGISKRGDTYLRTLLTHGARAVVNFQIKNRNPWIDKL
LSRRPHNVVVVAQSNKMARTIWALLVKNTEYVANHARNAAAL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttacaacatacggattggatttggcaaaaagggtcatgcaactgcactgggta
aacctggagaccggcgagattcaccgcaaacagttgaagcgccgtgcactcctggagttt
ttcgccaaccgccaaccgggaatcgtggcgatggaggcttgcggtagcgcccactattgg
ggacgggaattgcgtaagctggggcatgaggtccgcttgattgctgcccagtttgtgcgt
cccttcgtgaagaccaacaagaacgatgcggccgatgcggcagcgatctgggaagccgta
cagcggcctgatatgcgcttcgtggcggtcaagagtgaggaacagcaatccgttctgtcg
ctgcaccgtatgcgggagcaattgatcaagatgcgcactatgcaggtgaaccagatccgg
ggcctgctctacgaatttggtgctgatctgccgcagggccgccagcgggggctgaaagag
gttcctgatgctttggccgacctggaaaaatcgatatcgcccatgctgcgggacacggtt
cgtcagcaattaaaacgtcttgaagagatggacaaggatattgcggatatcgaaaagcgt
ttgacgctgtggaagaaaggccaagaggccgtgactcgattgatggctatccccggcgtg
gggctacttacggcaactgccattatcgccaccgtgggagatatgaagtcctttcgttca
ggacgggagtttgcggcgtttctggggctggttccccgccagagtgggaccggtggcaag
gtccgattactggggatcagcaaacggggggatacctatctccgaacattgctgacccat
ggagccagggcggtggtgaacttccagatcaagaatcggaatccctggattgacaaactg
ctcagtcggcgaccccataatgtggtggtcgtggcacagtccaacaagatggcgcgaacc
atctgggcgctgctggtgaaaaacacagaatatgtggccaatcacgctaggaatgcggcc
gccctatag

DBGET integrated database retrieval system