KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2799Help
Entry
Lferr_2799        CDS       T00758                                 

Definition
(GenBank) hypothetical protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACH84985
UniProt: B5ER34
Position
complement(2781316..2782125)
Genome map
AA seq 269 aa AA seqDB search
MIRIDVLRKVPEDLTLHWLAGVEQDDKKGWQVRIVTRGVSSGEFAMWRVPIGLFPVLALG
YSFSDGRLLPITYGEYSEVIIPNLAEGEEINSSDIPPELYSFEGKSQGVQRLLRYRVDQV
EYLVPTMELIRSLFLHNKTLANHIMQPGGIMTLFRPVEPGFHPRLQLDYTQQMPVRSLKR
PFILEFSWLAVDPDGQRAWDSVYERTFKQKYMTFDPPDLHDCGIKFRGVRKGNQWLILEI
SEFTGKRVPCRAPSKSPDMTAGVLCRSFW
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
ttgatcagaatagacgtattgcgcaaagtgcctgaagatttgacgctacactggctggcc
ggagtcgaacaagacgataaaaaagggtggcaggtccgtatagtcacccgcggcgtgtcg
tcaggcgaatttgccatgtggcgcgtacctattgggctgttcccggtgctggcactcggc
tatagcttctccgacggtagattgctcccaataacctacggcgaatattcggaagtgatt
attcccaatctggcggaaggagaggaaatcaactcgtccgacattccgccggaattatat
tcgtttgaaggcaaatcacagggggtgcagcgactcttgcgttatcgagtggatcaggtg
gagtatttggtcccgaccatggagctcatccgtagcctgttcctgcataataaaacgctt
gccaatcatattatgcagcctgggggcattatgacactcttcaggccggtcgaacctggg
tttcatcctcgtctgcagctcgattatacccagcaaatgccagtgagatcactcaagagg
ccatttatcttggaattttcttggctagcggtggatcctgatgggcaacgcgcctgggac
agtgtctacgaacggacattcaaacaaaagtatatgacctttgatcctcctgatctgcat
gactgtggaattaagtttcgtggagtgcggaaaggaaatcagtggcttatcttagaaatc
tccgagttcacggggaaaagggtaccctgcagggccccgtcaaagtcgcctgatatgaca
gcaggcgttttgtgccgctcattttggtga

DBGET integrated database retrieval system