KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2804Help
Entry
Lferr_2804        CDS       T00758                                 

Definition
(GenBank) glucosamine/fructose-6-phosphate aminotransferase, isomerizing
  KO
K00820  glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00250  Alanine, aspartate and glutamate metabolism
afe00520  Amino sugar and nucleotide sugar metabolism
afe01100  Metabolic pathways
afe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lferr_2804
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lferr_2804
Enzymes [BR:afe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Lferr_2804
Peptidases [BR:afe01002]
 Cysteine Peptidases
  Family C44
   Lferr_2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4 HisKA_3
Motif
Other DBs
NCBI-ProteinID: ACH84990
UniProt: B5ER39
Position
complement(2788779..2790614)
Genome map
AA seq 611 aa AA seqDB search
MCGIVGGVSKTDLVPMILEGLQRLEYRGYDSAGLAILGADADLLRVRSVGRVAELTAAVV
ERGLQGQVGIGHTRWATHGGVAECNAHPMISHEQIAVVHNGIIENFHALRAHLEAAGYTF
TSETDTEVIAHLVHHYRQTAPDLFAATRRAVGDLRGAYAIAVISSGDPETVCVARMGCPL
LLGVADDGHYFASDVAALLPVTRRVLYLEDGDVAMLQRQTLRITDQAGASRQREEHWSQL
SAAAVDLGPYRHFMQKEIHEQPRAVADTLEGALNSQLDLTDLWGDGAAAMFRDVDRVLFL
ASGTSHYATLVGRQWVESIVGIPAQAELGHEYRYRDSIPDPRQLVVTLSQSGETLDTFEA
LRRAKDLGHTRTLAICNVAESAIPRASALRFLTRAGPEIGVASTKAFTTQLAALYLLALS
LAKAQGHLNDVQQADHLDALRQLPGSVQHALNLEPQIQGWAARFASKDHALFLGRGLHYP
IALEGALKLKEISYIHAEAYPAGELKHGPLALVDRDMPVVVIAPNDRLLEKLAANMQEVH
ARGGELYVFADSDSHFNASEGVHVMRLPRHAGLLSPIVHAIPVQLLAYHAALVKGTDVDR
PRNLAKSVTVE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgtcggtggggtgagtaaaacagatctggtcccgatgattctggagggg
ttgcagcgcctggagtatcgtggctacgactctgccgggctggcgatattgggggccgat
gcggatttgctgcgggtgcgcagcgtcgggcgggtcgccgagctgaccgccgccgttgtc
gagcgtggcttgcagggtcaggtgggcatcggccacacgcgctgggccacccatggcggc
gtcgccgaatgcaatgcgcatcccatgatctcccatgaacagatcgctgtggtccataac
ggcatcatcgagaactttcatgccttgcgcgcccacctggaagcagcggggtacaccttc
acctccgagaccgatacggaggtcatcgcgcatctggtgcaccattatcggcagaccgcg
ccggacctgttcgcggcgacccgccgggcagtgggcgatctgcgcggcgcctatgccatt
gcggtgatctccagcggcgatccggagaccgtgtgcgtggcacggatgggctgcccgctg
ctgctgggcgttgccgatgatgggcattacttcgcctcggacgtggcggccctgctgccg
gtgacccgccgcgtgttgtatctcgaagacggcgatgtggccatgctgcagcggcagacc
ctgcggattacggatcaggccggagcgtcgcggcagcgggaagaacactggagccagctc
agtgcggcggctgtcgatctggggccttaccgccacttcatgcagaaggaaatccacgaa
cagccccgcgcggttgccgataccctggaaggtgcgctgaacagtcaactggatctgaca
gatctctggggagacggtgccgcggctatgtttcgcgatgtggaccgggtgctgttcctg
gcctccggcactagccactacgcgacattggtgggacgccaatgggtggaaagcattgtg
gggattccggcgcaggccgagctggggcacgaatatcgctaccgggactccatccccgac
ccgcgccagttggtggtgaccctttcgcaatccggcgaaacgctggatactttcgaggcc
ttgcgccgcgccaaggatctcggtcatacccgcacgctggccatctgcaatgttgcggag
agcgccattccgcgggcgtcggcgttgcgcttcctgacccgggccggcccagagatcgga
gtggcctcgaccaaggcgttcaccacccagttggcggcgctctatctgctggctctgtcc
ctggccaaggcgcaggggcatctgaacgatgtgcagcaggcggatcacctggacgccttg
cggcaactgccgggcagtgtccagcatgccctgaacctggagccgcagattcagggttgg
gcggcacgttttgccagcaaggaccatgcgctttttctggggcgcggcctgcactacccc
attgcgctggagggcgcgctgaagctcaaggaaatctcctatatccacgccgaggcttat
cccgcgggcgaattgaagcatggccccttggccctggtggaccgcgacatgcccgtggtg
gtgatcgcgcccaatgaccgcctcctcgaaaagctggccgccaacatgcaggaagtccac
gcccgtggcggtgagctctatgtttttgccgattcggacagccactttaacgccagtgag
ggcgtgcatgtgatgcgtttgccccgtcacgccggtctgctctcccccatcgtccatgct
atcccggtgcagttgctggcctatcatgcggcgctggtgaagggcaccgatgtggatcga
ccgcgtaacctcgcgaagagcgtgacggtggagtaa

DBGET integrated database retrieval system