KEGG   Archaeoglobus fulgidus DSM 8774: AFULGI_00024540
Entry
AFULGI_00024540   CDS       T03231                                 

Definition
(GenBank) hypothetical protein
Organism
afg  Archaeoglobus fulgidus DSM 8774
SSDB
Other DBs
NCBI-ProteinID: AIG99171
UniProt: A0A075WGP9
Position
complement(2118402..2118938)
AA seq 178 aa
MLVTAPAMAEDFSMNGTEFAAAFIKNTVSNLDLGAKFLHLLYEVNDTDTNSNLFQNLWGL
VYGGVLVAGWNNQVTAEVLETLADSDNLTSQRTNISESIRMMATNTSVVFGDTEGSQGLA
ALMKYQVKALQNTSITTTNSTGVEVPLVEAYAEALANTITDNVKFMMELFKAIPNALT
NT seq 537 nt   +upstreamnt  +downstreamnt
atgctggtaactgcaccggcaatggcagaagacttcagcatgaacggtacggagtttgcg
gctgcattcataaaaaacacggtttcaaacctcgatctgggagcgaagttcctgcacctg
ctctacgaggtgaacgacactgacacaaactccaacctcttccagaacctctgggggctg
gtttacggtggagttcttgttgcgggttggaacaaccaggtgacggcggaggttctggaa
acgctggcagacagcgataacctgacatcccagagaactaacatcagcgaatcaataagg
atgatggcgaccaacacctccgttgtcttcggcgacactgagggcagccagggactggca
gcgcttatgaagtaccaggtaaaggccttgcagaacacgtcgataacaaccaccaactct
accggagtcgaggtgccgctggttgaggcttacgccgaagcactggcgaacacgataacg
gacaacgtaaagttcatgatggagctgttcaaggcaatacctaatgctttaacgtaa

DBGET integrated database retrieval system