KEGG   Archaeoglobus fulgidus DSM 8774: AFULGI_00025940Help
Entry
AFULGI_00025940   CDS       T03231                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01634  sphinganine-1-phosphate aldolase [EC:4.1.2.27]
Organism
afg  Archaeoglobus fulgidus DSM 8774
Pathway
afg00600  Sphingolipid metabolism
afg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AFULGI_00025940
Enzymes [BR:afg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.27  sphinganine-1-phosphate aldolase
     AFULGI_00025940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Aminotran_1_2 Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIG99304
UniProt: A0A075WJ86
Position
complement(2228199..2229560)
Genome map
AA seq 453 aa AA seqDB search
MTIDDVLSLLEKAESEDLNPRTGRLFAYVYETGDENIRKVAEKALVRFAEKNLLDFTVFR
SAVFFEKEVVGFARNLMHGDAAVGSFTFGGTESIMLAVKAARDYYRKKEGTAEVPEILAP
ISIHPAFLKAADYLGLKVVRLPVKDAKGDVDAFAEAVSGKTALIALSAPNWPFGTIDPVE
EIAEIAAERNVLLHVDACLGGFILPFFEMLGEKIPKFDFRVEGVTSISLDAHKYGYAPKG
ASVVLFRDAELKKCSMFVDVTSPGYVFVNQAVLSSRPEGPLAAAFAVIKYLGVEGYKELA
SKILSARDKIYRGLKSLGFESVGEVESSVLAMTNPDVDLMGFVNNMKKLGWQLHLQKGLK
EYDIPDNIHLTLSPVHDGVAEKFVEDAAKALEMEPEVDTKQIYAMAERGEFAEIIKGIEE
GRIDSSVIPMLLESIPEKVAVELIKNIVVEWFR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacgatagatgatgtgctctcccttcttgaaaaggccgaatcggaagacctcaaccct
cgaaccggaaggcttttcgcctacgtttacgagaccggagatgagaacataaggaaggtc
gctgaaaaagctctggtgcgctttgctgagaaaaacctgcttgactttaccgttttcaga
agcgcggtattctttgagaaggaagtggtcgggttcgccagaaacctgatgcacggcgac
gctgctgttggctccttcacctttggcgggacggaaagcataatgctcgccgtgaaggct
gccagagattactacaggaagaaagagggaacggcggaggttcctgaaatacttgcacca
atctcgattcacccagcttttctgaaagccgctgactatcttggccttaaagttgtcaga
ctgccggtaaaggatgcaaagggtgatgttgatgcctttgctgaggccgtcagcggtaaa
acggcactaattgccttgtccgcacccaactggcctttcggaaccattgacccagtagag
gagattgcagaaattgctgcagagagaaacgtcctccttcacgtcgatgcatgcctcggg
ggcttcattctgcccttcttcgagatgctgggagagaaaataccgaagttcgatttcagg
gttgagggggttacctcaatctctctcgacgcgcacaagtacggctacgccccaaaggga
gcttctgtggtgcttttcagagatgctgaactgaaaaaatgctccatgttcgttgatgta
acctctccgggctacgtttttgtcaatcaagccgtgctgtcttcaagacctgaggggcct
ttagcagcagcctttgcggtgattaagtacctgggcgtcgagggctacaaggagcttgcc
tcgaaaattctatcggcgagagacaaaatttacagggggttgaagagtctaggtttcgag
agcgtcggagaggttgagagcagcgttctggcgatgacaaatccggatgttgacctgatg
ggcttcgtaaacaacatgaaaaagcttggctggcagcttcaccttcaaaaggggctgaaa
gagtacgacatccctgacaacattcacctcacgctgagcccggttcacgacggtgttgcg
gagaagttcgttgaagatgctgcgaaggctctggagatggagccggaggttgacactaag
cagatttacgcaatggctgaaaggggggagtttgccgaaatcataaagggcatagaggag
ggtagaatagactccagcgttataccaatgctgctcgaatccattccagaaaaggtggcg
gttgaactgataaagaacatcgttgtagagtggttcagatga

DBGET integrated database retrieval system