KEGG   Acidithiobacillus ferrivorans: Acife_0174Help
Entry
Acife_0174        CDS       T01595                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afi01100  Metabolic pathways
afi01110  Biosynthesis of secondary metabolites
afi01130  Biosynthesis of antibiotics
afi01230  Biosynthesis of amino acids
Module
afi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acife_0174
Enzymes [BR:afi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Acife_0174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh Vps8 DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AEM46411
UniProt: G0JQW7
Position
complement(188131..188922)
Genome map
AA seq 263 aa AA seqDB search
MADILKEIIARKREELAERKARLGLTELQSVVALTAPPRDFIGAIQAKIAQGQAAVIAEV
KKASPSAGVIREDFNPVIIAQDYATHGAACLSVLTDAHYFQGADLYLTAAREACTLPVLR
KDFCIDPYQVWEARAIGADAILLIVGALSDAELQSLEAIAQSLDLAVLAEVHDAAELQRA
LKLRTPLIGINNRDLRRFVTAIETTLQLLPEMPEGRIVVTESGIHRREDVATLRAAGVGA
FLVGEAFMRAAQPGAALEHLFFD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatacttaaagaaattattgcccgcaagcgcgaagagttggctgaacgcaaa
gctcgcctgggcctcacggagctgcaatcggtagtggccctgacggccccgccccgtgac
ttcattggcgccattcaggccaaaatagcccaaggacaagccgccgtgattgccgaagtc
aagaaggcatcgccgtcggcgggagttatccgcgaggacttcaacccggtgatcattgcc
caggattacgcgacccatggggcggcctgcctgtcggtcttgaccgatgcgcactatttc
cagggtgctgacctctatctgaccgccgcccgcgaagcctgtacactgccggtattgcgc
aaggatttctgtattgatccctatcaggtctgggaggcacgcgccatcggggccgatgcc
atcctgctcatcgtcggggcactgagcgatgccgaactacagagcctggaagccatcgcg
cagagcctcgatctggcggtactggcagaggtgcatgatgcggccgagttacagcgggca
ttaaagttgcgcacgcccctgatcggcatcaacaatcgggatctgcggcgctttgtcacc
gcgatcgaaaccacgctgcaactactgccggagatgcccgaagggcggatagtggtcacc
gaaagtggcattcatcgacgcgaagatgtggcgactttgcgcgcagcgggagtgggtgct
tttctcgtcggcgaggcattcatgcgcgccgcacagccgggagcggccctggaacatctg
ttttttgattaa

DBGET integrated database retrieval system