KEGG   Acidithiobacillus ferrivorans: Acife_0545Help
Entry
Acife_0545        CDS       T01595                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00900  Terpenoid backbone biosynthesis
afi01100  Metabolic pathways
afi01110  Biosynthesis of secondary metabolites
afi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acife_0545
Enzymes [BR:afi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Acife_0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C DUF3663
Motif
Other DBs
NCBI-ProteinID: AEM46751
UniProt: G0JTZ9
Position
complement(555604..556449)
Genome map
AA seq 281 aa AA seqDB search
MSENYPAPAKLNLMLRVVDQRSDGYHELQTVFQFIDLADQLQFDSRPAGQFSRSGGPEGV
PEADDLSIRAAKCLADVGAVHEGVHIHIDKILPMGGGIGGGSSDAATTLIVLNRLWRTGL
RREELMEIGASLGADVPVFIFGRSAWAEGVGERLQVLDALPESHYVLLHPQVFVSTREIF
TAPELTRHHVPSTIGAFLGGATENTLEPTVCARYPEVEHGARWLKNQGVHDVRLTGSGAC
VFGLVADNISAQQIAARVPAPWRAWSVRGCNKHPLYDLAEQ
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaattatcccgcacccgcgaagctgaatctgatgcttcgcgttgtcgaccag
cgcagcgacggttatcacgagttgcaaaccgtatttcagtttatcgatctggctgaccaa
ctccagtttgactcgcgccccgccggacaattttcccgcagcggcggaccggaaggcgtg
ccggaagcggacgatctcagtatccgcgccgcgaaatgcctggccgatgtcggcgctgtc
cacgaaggagtccatattcacattgataaaatcctgcccatgggtgggggtatcggcggg
ggctcctcggatgccgctaccaccctcatcgtgctcaatcggctgtggcgtaccggtcta
cgccgcgaagaactcatggaaattggtgccagcctcggtgctgacgttcctgtatttatt
ttcggacgtagtgcctgggcggagggtgtgggcgagcgtttgcaagtgctcgacgccctc
ccggaaagtcactatgtgctgctgcacccgcaggtgttcgtaagtacccgggagattttc
actgcccctgaattgacacggcatcatgtgcccagcacaataggcgcgtttctcggcggg
gcgacggaaaacaccttggaacctacggtgtgcgcccgctacccggaagtcgaacatggt
gcgcgctggctaaaaaatcagggcgtgcatgatgttcgtttgacgggtagcggcgcctgt
gttttcgggctggtagcggataatatttccgcacaacaaattgctgcgcgggtgcctgcc
ccctggcgcgcatggtccgtgcgtggatgcaataagcatcctctgtacgatcttgccgag
caatga

DBGET integrated database retrieval system