KEGG   Acidithiobacillus ferrivorans: Acife_1260Help
Entry
Acife_1260        CDS       T01595                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
afi  Acidithiobacillus ferrivorans
Brite
Enzymes [BR:afi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Acife_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 MTS Methyltransf_23 Methyltransf_32 GCD14 Methyltransf_18 DOT1
Motif
Other DBs
NCBI-ProteinID: AEM47415
UniProt: G0JPU0
Position
complement(1257923..1258576)
Genome map
AA seq 217 aa AA seqDB search
MDFDTLRRTMIDTQIRTWDVLDPRVLATVAQVKRELFVPTPYRHLAFADFTLPLGHSEIM
WTPKMEARVLQELDLHEQDRVLEIGTGSGYLTALMAQLAGMVHSVEDRAELSRTAAGCLR
VQGVHNAHLHIGDGATGWADNAPYDAICITGSLPVLPEIFKEQLTVGGRLIAILGTGPAM
RVRRIFHSQPGIFEYSELFETEIPPLRHKPLPARFVF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggactttgacaccctccgccgtaccatgattgacacccagattcgcacttgggatgtg
ctcgaccctcgtgtgctggccactgttgcgcaagtaaagcgtgagcttttcgtgccgacc
ccctatcggcatttggcttttgctgattttactttgccgctggggcacagcgagatcatg
tggacgccaaagatggaggcgcgggtcttgcaagagctggatctgcatgaacaggatcgg
gtgctggagatcggcaccggaagtggctacctgacggcactgatggcacaactcgcgggg
atggtacacagtgtcgaggatcgcgccgaactctcccgaacggcagcaggctgtttgcgg
gtgcagggcgtgcataatgcccacctgcatattggtgatggcgccactggctgggcggac
aatgcaccctatgatgccatctgtatcaccggatccttgccggtgctgccggagatcttc
aaagagcaactgaccgtcggcgggcgattaatagctattctcggcaccggccccgccatg
cgggtgcggcggattttccactcccagccaggcatttttgaatactcggaactcttcgag
acagaaattccgcccttgcgtcacaagccgctgccggcccgcttcgtattctga

DBGET integrated database retrieval system