KEGG   Acidithiobacillus ferrivorans: Acife_1474Help
Entry
Acife_1474        CDS       T01595                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00260  Glycine, serine and threonine metabolism
afi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afi01100  Metabolic pathways
afi01110  Biosynthesis of secondary metabolites
afi01130  Biosynthesis of antibiotics
afi01230  Biosynthesis of amino acids
Module
afi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acife_1474
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acife_1474
Enzymes [BR:afi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acife_1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEM47621
UniProt: G0JRM8
Position
1487493..1488794
Genome map
AA seq 433 aa AA seqDB search
MKIRIAFPLLQLQIQPYIFDTNSKAALRVMTEQDLFNIEASASGMFGSFGGAYMPETLMP
AVLELQNCYAEIRTSSTFWNEYHQLLRDYVGRPSPMFYARNSSEQIGGAKIFLKREDLNH
TGAHKINNCIGQILLAKRMGKTRVIAETGAGQHGVATASVCALFRMRCIIYMGKKDIERQ
TPNVRRMQLLGAEVRQVDLGGATLKDAMNEALRDWITNVDDTYYLLGTGAGPHPYPQMVC
DFQRVIGIEAREQIQHHIDGLPQALVACVGGGSNAAGLFIPFLSDTAVRLYGVEAAGRGL
DTEEHAASLQRGKPGVLHGNLTYLLQDADGQIKNAHSVSAGLDYPGIGPLHAHWYESHRV
SYVSATDSEAVAAFHWLSRNEGIIPALESSHAIAYARKLAATMPRESAIIVNLSGRGDKD
IDTVFNFKTQGAI
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcagaatcgcttttcccctgttgcagttacagatccagccatatattttcgat
acgaacagcaaggcggcattacgagtgatgacagaacaagatcttttcaacatcgaagcg
agcgcatctggcatgtttggaagttttggcggggcctatatgcctgagacgctaatgcca
gccgtacttgaattgcaaaattgttacgcggaaatacgcacatcgtccacgttttggaat
gaatatcaccagcttctgcgggattatgttggtcgcccttctcccatgttttatgcccgc
aatagcagtgagcagattggtggtgcgaagatatttcttaagcgcgaagatctaaaccat
accggagcgcataaaataaataattgtattggtcagatattgttggccaagcgcatgggc
aagacgcgggtgatcgccgaaaccggggccggtcagcacggcgtggctacggcgagcgtc
tgtgcgctatttcgcatgcgctgcattatttatatgggcaagaaagacatcgaacgacag
acaccgaacgtgcgacgcatgcagttgcttggtgcagaagtacggcaggttgatttgggc
ggcgccacacttaaagatgccatgaatgaagcgttacgcgactggatcaccaatgtggat
gatacctattatctgttaggaactggagcaggtccacacccctatccgcagatggtgtgt
gactttcagcgtgtaattggaatagaggcgcgcgaacaaattcaacatcatatcgacggc
cttcctcaagccttggtcgcctgcgtcggtgggggatctaacgccgctggtctattcatt
ccgtttctatcggatacggctgtcaggctctatggtgtggaggcggctggtcgcggattg
gataccgaagagcatgctgcctcactgcaacgcggaaaacccggggttctgcacggtaat
ctgacgtacttgctgcaggatgctgatggtcagataaagaacgcccactcggtttcggct
ggtctcgactatcccggcatcggaccactgcacgctcattggtatgaatcgcacagggtt
tcttatgtgtctgcaactgattcagaggctgtggccgccttccattggcttagtcgtaat
gaaggcattatcccggcattggaaagttcgcacgcaattgcctacgcacgcaagcttgcc
gccacgatgccgcgagagtccgcgattatcgtcaatctgagcggacgtggtgacaaggat
atcgacacagtttttaactttaaaacacagggagcgatatag

DBGET integrated database retrieval system