KEGG   Acidithiobacillus ferrivorans: Acife_2225Help
Entry
Acife_2225        CDS       T01595                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00230  Purine metabolism
afi01100  Metabolic pathways
Module
afi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Acife_2225
Enzymes [BR:afi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Acife_2225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_33 Thymidylate_kin IstB_IS21 MMR_HSR1 AAA_25 AAA_18 AAA_16 ABC_tran AAA_26 AAA_23
Motif
Other DBs
NCBI-ProteinID: AEM48338
UniProt: G0JNJ9
Position
complement(2205471..2206109)
Genome map
AA seq 212 aa AA seqDB search
MTGGAERGILWIISAPSGAGKTSLARALVAATPQLRTSVSYTTRPPRPGEVEGTDYHFVP
TEAFTAMAERGEFLESARVHGNGYGTSEPWVKSQLFAGTDCLLEIDWQGARQVRERLPGQ
AVSIFILPPSVAALAERLRGRGQDSETVIARRLAAAREELLHYDEFDYLVVNDHFQDALA
DLQSIVHAEHLRRGYQEYAQHQRLKNLLGMSG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtggagcagaacgcggtatcctgtggattatttcggcacccagcggggcggga
aagaccagtctggcgcgggcgttggtagcggcgactccgcaattgcggacctccgtctct
tacaccacccggcccccgcggccaggtgaggttgagggaacggactatcacttcgttccc
acggaagccttcacggccatggcggaacgcggtgagtttctggagtccgccagggtgcat
ggcaatggttatggcaccagtgaaccttgggtgaagagccagttgttcgctgggacggac
tgtctgctggaaatcgactggcaaggtgcgcggcaggtgcgggaaagattgccggggcag
gcagtcagtatttttatcttgccgccctcggtcgccgccttggcggaacgtttgcgcggc
cgtggccaggattcagagacggttatcgcgcgcaggctggcggcagcacgtgaagagctg
ttgcattatgacgagtttgattatctggtggtgaatgaccacttccaggatgcgttggcc
gacttgcagagcattgtccatgccgagcatttgcggcggggttatcaggagtatgcacag
catcaacgattaaagaatcttctcggtatgagtggttaa

DBGET integrated database retrieval system