KEGG   Acidithiobacillus ferrivorans: Acife_2232Help
Entry
Acife_2232        CDS       T01595                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00630  Glyoxylate and dicarboxylate metabolism
afi00710  Carbon fixation in photosynthetic organisms
afi01100  Metabolic pathways
afi01110  Biosynthesis of secondary metabolites
afi01120  Microbial metabolism in diverse environments
afi01200  Carbon metabolism
Module
afi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:afi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Acife_2232
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acife_2232
Enzymes [BR:afi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Acife_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEM48345
UniProt: G0JNK6
Position
complement(2211860..2213281)
Genome map
AA seq 473 aa AA seqDB search
MAVKTYSAGVKDYRNTYWEPDYSVKDTDILAVFKITPQAGVDREEAAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYKIEDVPGDDTCFYAFIAYPIDLFEEGSVVNVFTSLVGNVFGF
KAVRALRLEDVRFPIAYVKTCGGPPHGIQVERDIMNKYGRPLLGCTIKPKLGLSAKNYGR
ACYEGLRGGLDFTKDDENVNSQPFMRWKQRFDFVMEAIEKAERETGERKGHYLNVTAPTP
EEMYKRAEYAKEIGAPIIMHDYITGGFCANTGLANWCRDNGLLLHIHRAMHAVLDRNPHH
GIHFRVLTKILRLSGGDHLHSGTVVGKLEGDREATLGWIDIMRDKFIKEDRSRGIFFDQD
WGSMPGVMPVASGGIHVWHMPALVTIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNRGVPIEKEGKAVLTDAAKHSPELKVAMETWKEIKFEFDTVDKLDVAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaagacctatagcgcgggtgtgaaggattaccggaacacctattgggaaccg
gattacagcgtcaaggatacggatatccttgccgtgttcaaaattactccccaggcgggc
gtggatcgtgaggaagccgctgctgcggttgccgccgaatcctccaccggcacctggacc
acggtgtggaccgatctcctcaccgatctcgactactacaagggccgtgcgtataagatc
gaagacgttcctggcgatgatacctgcttctatgcgttcatcgcctaccccatcgacctg
ttcgaagagggttccgtggttaacgtcttcacctcgctggtcggtaacgtgttcggcttc
aaggctgtccgtgccctgcgtctggaagacgtgcgtttcccgatcgcgtacgtcaagacc
tgcggcggcccaccccacggcattcaggtcgagcgcgacatcatgaacaagtatggtcgt
ccgttgctgggctgcaccatcaagcccaagctggggttgtcggccaaaaattatgggcgt
gcctgctatgagggtttgcgtggcggtctggatttcaccaaggacgacgaaaacgtcaac
agccagcccttcatgcgttggaagcagcgtttcgacttcgtcatggaagcgatcgagaag
gcagagcgggagactggtgagcgcaagggtcactacctgaacgtcaccgcgccaaccccg
gaagagatgtacaagcgtgcggaatacgccaaggaaattggtgcgcccatcatcatgcat
gactacatcaccggcggtttctgtgccaacacgggtctggccaactggtgtcgcgataac
ggtttgctcctgcacatccaccgcgccatgcacgctgtgctcgaccgtaacccgcaccac
ggtattcatttccgcgtgctgaccaagattctccgtctgtccggcggcgatcatctgcac
tccggtacggtggtaggcaagctcgaaggcgaccgcgaggcgaccttgggctggatcgac
attatgcgtgataagttcatcaaggaagaccgcagccgcggtatcttctttgaccaggac
tggggttccatgccgggggtgatgccggttgcttccggtggtatccatgtttggcacatg
ccggcgctggtcaccatctttggtgatgactcggtgttgcagttcggcggcggtactctg
ggccacccctggggcaatgctgctggcgctgctgccaaccgtgttgcgctggaagcctgc
gtggaagcccgcaaccgcggtgtgcccatcgagaaagaaggtaaggccgtcctcactgac
gctgccaagcattctcccgaactcaaggtggccatggaaacgtggaaagagatcaagttc
gagttcgataccgtcgacaagctggacgtcgcccacaagtaa

DBGET integrated database retrieval system