KEGG   Acidithiobacillus ferrivorans: Acife_2940Help
Entry
Acife_2940        CDS       T01595                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00240  Pyrimidine metabolism
afi00250  Alanine, aspartate and glutamate metabolism
afi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Acife_2940
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acife_2940
Enzymes [BR:afi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Acife_2940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEM49014
UniProt: G0JTP9
Position
complement(2896399..2897382)
Genome map
AA seq 327 aa AA seqDB search
MSTTLRFGEGNLQYDAQGRLRHLLSIEGLRERELLQILDTAESFLSIAKRSVKKTPTLRG
RTIVNLFFENSTRTRSTFELAAKRLSADVLNIAVSTSSASKGESLIDTVDNLMAMQVDGF
VLRHPEAGAAHLIARHLGDSALVVNAGDGQHAHPTQALLDVFTIRRLAGPIENRVVAIVG
DVLHSRVARSQIHALSILGCPEIRVIGPRTLVPEELSALGVHVYHDLQAGLRGVDVICAL
RLQRERMASHRLPSLNEFYHRFGLTPERLQWAAPGALVLHPGPMNRGVEIASEVADGAQA
VILQQVAHGLAMRMAVLTILAGAAGGE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtactaccctgcgttttggtgaaggtaacttgcaatacgatgcgcagggccgtctg
cgccatctgctcagtatcgaaggattgcgggagcgggaattgctgcagatcctggatacg
gcggagtctttcctcagcattgcaaagcgcagtgtcaaaaaaacgcctaccctgcgcgga
cgcaccatcgtcaatctcttttttgagaacagcacacggacgcgcagtacctttgagctg
gccgccaagcgcctctcggcggatgtgctgaatattgcggtcagtacgagtagtgccagc
aaaggcgagtccctcattgataccgtcgataatctgatggccatgcaggtggatggtttc
gtcctccgtcatcccgaagcgggtgcagcccatctgatcgcccgccatctgggtgactcg
gcactggtggtgaatgccggtgacggccagcacgcccatcccacccaggccttactggat
gtgttcaccatccgtcgcctggcggggccgattgaaaaccgagtggtggccatcgtcggc
gatgtgctccattcgcgggtggcgcgctcgcagattcatgccttgtccattcttggttgc
ccggaaattcgcgtcatcggcccgcgcaccctggtgcccgaagaactttcggcgttgggc
gtgcatgtttaccacgatctgcaggccggtttgcgcggggtggatgtgatttgtgccctg
cgcctgcaacgggagcgcatggcgtcgcaccgcctgcccagtctgaatgaattttatcac
cgtttcgggctgacaccggagcgcttgcagtgggcagcacccggcgcgctggtgctgcat
ccgggtcctatgaatcgcggggtggagattgcctcggaggtggccgacggtgctcaggcg
gtgattctccaacaggtagcccatggtttggcgatgcggatggcggtgctcaccatcctc
gctggcgcggcgggcggggagtga

DBGET integrated database retrieval system