KEGG   Acidithiobacillus ferrivorans: Acife_2973Help
Entry
Acife_2973        CDS       T01595                                 

Definition
(GenBank) pilus assembly protein TraF, putative
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
afi  Acidithiobacillus ferrivorans
Brite
KEGG Orthology (KO) [BR:afi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afi02044]
    Acife_2973
Secretion system [BR:afi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Acife_2973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraF TonB_N
Motif
Other DBs
NCBI-ProteinID: AEM49047
UniProt: G0JTT2
Position
complement(2920935..2921900)
Genome map
AA seq 321 aa AA seqDB search
MNGLARALAAIGVAAAMLTAMPGAFAGPLDSNAHGWFWYQLPPPPPPKPKPRPLPIMAPK
PVVRPKPKPKKPQVLSVKWIRVHLKKYRNEAINNPSTKNVTNYLSLQKVMFDKAQNFAEK
FVQVANTNPVLNYSNLVPRSNAGNSAFNTYIADNRQKALQYLTKKVGMWVFVKHDCPFCN
MQLGQYRHLLQLAHFRTVYIDVNHGAISGVPKSAVFVQDHGQAKMLHLVETPAIVMVWPP
DNFAVVTQGYQVAGTLMQNIVADAGYVHLLPKKLAQWSTSAYERGVMTTQEIQAAEKEGI
TAPGQISNYVQNQTENRIHTW
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgggctggcacgcgctctggcagccatcggcgtggccgccgcgatgctcacggcc
atgccgggcgcattcgcaggcccgctcgatagtaacgcgcacggctggttctggtatcag
ctcccgccgcctccgccaccgaagcccaagccgcggccattgcccatcatggctccaaag
ccagtggtaaggcccaaacccaaacccaaaaaaccacaggttctttcggtaaaatggatc
cgcgtgcatctcaagaagtaccggaatgaggcgatcaataatcccagcacgaaaaacgtc
accaattacctatcgcttcaaaaggtgatgttcgacaaggcccagaatttcgccgagaag
ttcgtgcaggtcgccaataccaatcccgtgctcaattactcgaacctggtaccccggtcc
aatgccggcaacagcgcgtttaacacctacattgccgacaaccgccagaaggcgcttcaa
taccttaccaagaaggtcggtatgtgggtcttcgtcaaacacgactgcccattctgcaac
atgcagctcggtcagtatcgtcatcttctacagctcgcccacttccgcacggtctacatc
gacgtgaatcatggcgcgatctctggcgtcccgaagagcgccgtttttgtccaggatcat
gggcaagccaaaatgctgcacctggtagaaacaccagccatcgtgatggtctggccacca
gataattttgccgtcgtgacccagggataccaggtggcgggcaccctgatgcagaacatt
gtggccgatgccggatatgtgcatcttctacccaagaaacttgcccagtggtccaccagt
gcctacgagcgcggagtcatgaccacgcaagagattcaggctgctgaaaaagagggcatc
accgctcccgggcagatcagcaattatgtgcagaaccagactgaaaaccggattcatact
tggtag

DBGET integrated database retrieval system