KEGG   Acidithiobacillus ferrivorans: Acife_3257Help
Entry
Acife_3257        CDS       T01595                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00860  Porphyrin and chlorophyll metabolism
afi01100  Metabolic pathways
afi01110  Biosynthesis of secondary metabolites
afi01120  Microbial metabolism in diverse environments
Module
afi_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Acife_3257
Enzymes [BR:afi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Acife_3257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEM49315
UniProt: G0JMF3
Position
complement(3186182..3186970)
Genome map
AA seq 262 aa AA seqDB search
MNGISLQGKGIVVTRPRAQAGEMLTLLQAQGARPILFPAVQIEAPENWQSLDDALHQLAA
YDWVIFSSRNAVAFALSRLQSRNLSWPTGPRIAAVGRETAKALREFGLQVDLVPRRFSSE
GLLESPELVAVQEQRIALFAGDQGRELLEKTLGERGAVIDKVLCYRRGIPGANPTPLLHA
WARGELDAVTVTSPEIFNNFYQMVGGLGQRWLKNTPIIAISPLTAAAVTTVGLAAPWIAP
EASAAGMLAALMVWAQGLEPVA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtatttcactgcaaggcaaaggcatcgtggtcacccggccgcgcgcgcaggct
ggcgagatgctgacgctgttgcaagcgcaaggcgcacgccccattttgttccccgccgta
cagattgaggcgccggagaactggcagtctctggatgatgctttgcatcagctggcggcg
tatgactgggtgattttttccagccgcaacgccgtcgcttttgccctcagccgcttgcag
agtcgtaacctgtcctggccgacagggccccgtatcgcggcggtgggtcgggaaaccgcc
aaggcgctgcgtgagtttggtctgcaggtcgacctggtcccccggaggttcagctccgag
gggttgctggaaagcccggagttggtggccgtgcaggaacagcgcatagcgctgtttgcc
ggtgatcagggcagggagttactggagaagacgctgggcgagcgcggtgcggtcatcgac
aaggtattatgctaccggcgcggtattcccggcgccaatccgacgccgttattgcatgcc
tgggcgcgcggcgaactggatgccgtcaccgtgaccagcccggagatcttcaataatttc
taccagatggtgggggggctgggacaacgctggctgaagaacacgcccattatcgccatt
agccccctcaccgccgccgccgtcaccacggttggtctggcggcgccctggattgccccg
gaagccagcgcggccggcatgttggcggcgctgatggtatgggcgcaaggtctggagccc
gttgcatga

DBGET integrated database retrieval system