KEGG   Acidithiobacillus ferridurans: AFERRID_06320Help
Entry
AFERRID_06320     CDS       T05847                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
afj  Acidithiobacillus ferridurans
Pathway
afj00450  Selenocompound metabolism
afj00970  Aminoacyl-tRNA biosynthesis
afj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AFERRID_06320
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AFERRID_06320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:afj01007]
    AFERRID_06320
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:afj03016]
    AFERRID_06320
Enzymes [BR:afj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AFERRID_06320
Amino acid related enzymes [BR:afj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AFERRID_06320
Transfer RNA biogenesis [BR:afj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AFERRID_06320
 Prokaryotic type
   Other AARSs
    AFERRID_06320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: BBF64414
UniProt: A0A2Z6II27
Position
616152..618188
Genome map
AA seq 678 aa AA seqDB search
MKRRILITSALPYANGPIHLGHLVEYTQTDIWARYQRLRGHDCVYVCADDAHGTPIMLRA
QSEGITPEELITRMHGDHLRDFTGFGIQFDLYHSTHSPENFEISQSIYRVLRAADYINVR
EIEQAYDPVAGIFLPDRFIRGTCPRCGAADQYGDSCEICGATYSPTDLINPVSAVSGAVP
ERRSSEHYFFQLGDFSDFLRRWIHSGTLQEEVAHKLDEWFSIGLSDWDISRDAPYFGIPI
PDAPGKFFYVWLDALPGYMAATQHWCAAHGRNLADYWGPDSTAEIYHFIGKDIIYFHGLF
WPAMLKGSGHRLPTGIFAHGHLTVNGAKMSKSRGTSITAGQYLQHLNPEFLRYYIATKLN
SHVEDIDLNLEDFLLKGNGDLVGKVVNLASRAAGFIHRSFAGRLAASLGKDQAFYDGLLQ
TQEAIGEAYAEREYGKAMRDIMALADQINAYVDQNAPWTLAKDPAQHESLHRVVTVTLNG
FRVLITLLSPVLPELSRKALEFLQCELDWAGLTRPLLDHQILPYTHLLQRMEKTQVDALI
QNPAESPATAPGMATAPVPTPVPAEAREENPVIGMDDFSKVDLRIARIVAADNVDGADKL
LHLTLDIGEGTRSVFAGIKSAYDPASLVGRLTVMVANLAPRKMRFGLSEGMVLAASGPEG
GPFLLSPDSGAQPGMRVK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacgcatactgatcaccagcgccctcccctacgccaacggccccatccatctc
gggcatctcgtggagtacacccaaaccgacatctgggcccgctatcagcgcctgcggggc
cacgactgcgtctatgtctgcgccgatgatgcccatggcacgccgatcatgctccgtgcc
cagagcgagggcatcacaccggaagaactcatcacccgcatgcacggcgatcatctccgc
gacttcaccggcttcggcattcagttcgatctgtatcacagcacccactcgccggaaaac
tttgaaatttctcagagtatctatcgcgtcctgcgggcggcggattacatcaacgtccgc
gaaatcgaacaggcctacgatcccgtcgccggcattttcctgcccgaccgcttcattcgc
ggcacttgcccgcgctgcggcgcggcggaccagtatggggatagctgcgagatctgcggc
gccacctacagccccaccgaccttatcaaccctgtttccgcggtctccggcgccgtaccc
gagcgccgcagctcggagcactacttttttcagcttggggatttcagcgacttcctccgg
cgctggattcacagcggtaccctgcaggaagaagtcgcccacaagctcgatgaatggttc
agcatcggcctgtccgactgggacatcagccgcgacgccccctacttcggcattcccatt
cccgacgcgccgggcaaattcttttatgtctggctggatgcattgcccggctacatggcc
gccacccagcactggtgcgcggcccacggccgcaatttggccgattactggggcccggat
tccacggccgagatctaccattttatcggcaaggacatcatttattttcacggcctgttc
tggccggccatgctcaagggttccggacaccgcctgccgacgggcatattcgcccacgga
cacctgacggtaaacggcgccaaaatgagcaagtcgcgcggcacctccattaccgccggg
cagtatctccagcacctgaatcccgagttcctgcgttattacatcgccaccaagctcaac
agccatgtggaagatatcgacctcaatctcgaagacttcctgctcaagggcaatggcgac
ctggtcggcaaggtggtcaatctggcctcgcgcgcggcgggtttcatccaccgcagcttt
gcgggccgactggccgcttccctgggcaaggatcaggccttttatgacgggctgctgcag
acccaggaggccatcggcgaggcctacgccgaacgggaatatggcaaggccatgcgcgac
atcatggcgctggcggatcagatcaacgcctatgtggaccagaacgccccctggactttg
gccaaagacccggcccagcacgagtccctgcaccgggtagttacggtcactctgaacggc
ttccgagtgctgatcaccctgctcagccccgttctgccggaactctcgcgcaaagcgctg
gaattcctgcagtgcgaactggactgggcgggcctgaccaggccgcttctcgatcaccag
atcctaccctacacccatcttttacaacgtatggaaaaaacccaggtggacgccttgatc
cagaatcccgcagaaagtcccgcgacagccccaggcatggcgacggcgccagtgcccacg
cccgtacctgccgaggccagggaggagaaccccgttatcggcatggacgacttcagcaag
gtggatttgcgcatcgcgcggatcgttgccgcggacaacgtggacggcgcggacaaacta
ctgcacctcaccctggacatcggcgagggcacccgctcggtctttgccggcatcaagagc
gcttacgatcctgccagcctcgtcggcaggctgaccgtgatggtcgccaatctggccccc
agaaagatgcgcttcggcctgtccgagggcatggtgctcgccgccagcggtccggagggc
ggccctttcctgctctctcccgacagcggggcccagcccggcatgcgggttaaatag

DBGET integrated database retrieval system