KEGG   Acidithiobacillus ferridurans: AFERRID_15130Help
Entry
AFERRID_15130     CDS       T05847                                 

Definition
(GenBank) Transcriptional regulatory protein OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
afj  Acidithiobacillus ferridurans
Pathway
afj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:afj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AFERRID_15130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:afj02022]
    AFERRID_15130
Two-component system [BR:afj02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   AFERRID_15130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: BBF65295
UniProt: A0A2Z6IMG2
Position
complement(1460334..1460819)
Genome map
AA seq 161 aa AA seqDB search
MADRVQGLDVGADDYLSKPFEPQELVARIRAVLRRSQDQRSSDPTPGAIIFGPFRLALDS
RSLWRNDEKISLTDSEFSILHALASHPWQPLSRDRLLAMTHGNDDATPGSRGIDVFISRL
RRLVEDDPGEPHYIQTVWGRGYVLVPDGGDATPREEGTLPG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
ttggccgaccgggtacagggcctcgatgtgggcgccgatgactatctctccaagcccttt
gagccccaggaactggttgcacgcatccgcgccgtgctgcgccgcagtcaggatcagcgc
agcagcgacccaacccccggcgccatcattttcggccctttccgcctcgccctcgacagt
cgcagtctctggcggaatgacgagaaaatctcccttaccgacagcgagttttccattctg
cacgcgctggccagtcatccctggcagccgctctcgcgggaccgcctgctggccatgacc
catggcaacgacgacgccacaccgggttcacggggtatcgatgtgtttatctcgcgcttg
cgacgccttgttgaagacgatcccggcgaaccacactatattcagaccgtctgggggcgg
gggtatgtgttggtacccgatggcggagatgccacacccagggaagaaggcactttaccc
ggatga

DBGET integrated database retrieval system