KEGG   Acidithiobacillus ferridurans: AFERRID_16530Help
Entry
AFERRID_16530     CDS       T05847                                 

Definition
(GenBank) Glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
afj  Acidithiobacillus ferridurans
Pathway
afj00860  Porphyrin and chlorophyll metabolism
afj00970  Aminoacyl-tRNA biosynthesis
afj01100  Metabolic pathways
afj01110  Biosynthesis of secondary metabolites
afj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AFERRID_16530
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AFERRID_16530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:afj01007]
    AFERRID_16530
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:afj03016]
    AFERRID_16530
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:afj02048]
    AFERRID_16530
Enzymes [BR:afj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     AFERRID_16530
Amino acid related enzymes [BR:afj01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   AFERRID_16530
Transfer RNA biogenesis [BR:afj03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AFERRID_16530
 Prokaryotic Type
   Other AARSs
    AFERRID_16530
Prokaryotic defense system [BR:afj02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    AFERRID_16530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: BBF65435
UniProt: A0A2Z6IMM5
Position
1594133..1595533
Genome map
AA seq 466 aa AA seqDB search
MSVRTRFAPSPTGYLHIGGVRTALYSWLHARQQGGRFILRIEDTDVERSTPEATVAILEG
MAWLGLDWDEGPFYQMRRMDRYREVLAQMLAAGTAYHCYCSREEVEAMREDQRQRGEKPR
YDGRCRQRTTAPEGVAPVIRFRSPDDGETVVEDLIHGTVRFQNSEMDDLIIARSDGTPTY
NFCVVVDDWDMGITHVIRGDDHLNNTPRQMQILQALGARVPVYAHVPMILGPDKQKLSKR
HGAVSVLEYREQGFLPDALLNFLVRLGWSHGDQEIFTREEMVEFFRIDAVNKAASAFNAE
KLLWINAQHMQRLTPEGLAQHLLPYLAAVGVTESLLVAGPELSAVVALLQERSKTLVEMA
AAAAMFYVAPVAGEPKDVEKHLRGQGALLVILAQALDVLPNWEAAAIHSVIQELAVTHAD
GKMGKVAQPLRVAVAGRAVSPPIDATLALLGKEETLARLRRAGRWA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtccgtacccgttttgctcccagtcccaccggttatctgcatattggcggtgtc
cgcaccgcactctactcgtggttgcacgcgcgtcagcagggggggcgtttcattttgcgt
atcgaggatacggacgtggagcgttcgacgccggaagcaacagtcgccattctggaggga
atggcctggctggggctggactgggacgagggaccgttctatcagatgcggcgcatggac
cgctaccgggaagtgctggcgcagatgctggcggcgggaacggcctaccattgctattgc
agtcgggaagaagtggaggccatgcgcgaggatcagcgccagcgcggcgagaaaccgcgc
tatgacggccgttgccggcagcgcacgacggcgccggagggggttgcgccggtgatccgc
ttccgcagcccggacgacggcgaaacggtggtggaagacctgattcacggtacggtgcgc
tttcagaatagcgaaatggacgacctgatcatcgcccgctccgacggaacgccgacctac
aatttctgcgtggtggtggatgactgggatatgggcatcacccatgtgatccgcggcgac
gatcatctcaacaacaccccgcggcagatgcagattctgcaggcgctgggcgcgcgggtg
ccggtttatgcccatgtgccgatgattctcggtccggacaagcagaagctgtccaagcgt
cacggggcggtgagcgtgctggaatatcgtgagcaaggcttcctgcccgacgcgctgctc
aattttctggtgcggctgggctggtcccatggcgatcaggaaattttcacccgcgaggaa
atggtggaatttttccgcatcgacgcggtgaacaaggcggcatcggccttcaacgcggag
aagctgctgtggatcaatgcccagcatatgcagcggctgacgccggaggggttggcgcag
catctgctgccttacctcgccgccgtgggcgtaaccgagtctttgctggtggccgggccg
gagctttcggcggtggtggcgctgttgcaggagcgctccaagaccttggtggagatggct
gcggcggcggcgatgttttatgtggcgccggtggccggtgaacccaaagatgtggagaag
catctgcgcggacagggcgccttgctggtaatcctggcgcaggcgctggacgtgttgccg
aactgggaggcggcggcgattcacagcgtgattcaggaactggcggtgacccatgccgac
ggcaagatgggcaaggtcgcgcaacccctgcgggtggcggtggccgggcgggcggtgtca
ccacccatcgatgcgaccctggccttattgggtaaggaagagacgttggcgcgtctgcgg
cgggcgggacgatgggcgtga

DBGET integrated database retrieval system