KEGG   Acidithiobacillus ferridurans: AFERRID_20200Help
Entry
AFERRID_20200     CDS       T05847                                 

Definition
(GenBank) Putative gamma-glutamyltransferase YwrD
  KO
K22602  oxamate amidohydrolase [EC:3.5.1.126]
Organism
afj  Acidithiobacillus ferridurans
Pathway
afj00230  Purine metabolism
afj01100  Metabolic pathways
afj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AFERRID_20200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:afj01002]
    AFERRID_20200
Enzymes [BR:afj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.126  oxamate amidohydrolase
     AFERRID_20200
Peptidases and inhibitors [BR:afj01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   AFERRID_20200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: BBF65802
UniProt: A0A2Z6IK01
Position
1948756..1949049
Genome map
AA seq 97 aa AA seqDB search
MSKLQIQSLYHEFGTGVVAGNTGVLWNNRGCAFSLEPGHINMLEPGKRPFHTLNPALYAE
QGRVQLAYGSMGGMASPKPRRHYSCASSTMGFPSPSQ
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacttcagattcagagtctctaccatgagtttggtactggcgtggtggccggt
aatactggggtactgtggaacaatcgcggctgtgctttttctctggagccggggcatatc
aatatgctggagcccggaaaacgcccttttcatactctgaatcccgcgctttatgccgag
caggggcgggtgcaactcgcctacggcagtatgggggggatggccagccccaaacccagg
cggcactactcatgcgcgtcaagcactatgggctttccctcgccgagtcagtag

DBGET integrated database retrieval system