KEGG   Acidithiobacillus ferridurans: AFERRID_20780Help
Entry
AFERRID_20780     CDS       T05847                                 

Definition
(GenBank) Putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
afj  Acidithiobacillus ferridurans
Pathway
afj00790  Folate biosynthesis
afj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AFERRID_20780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afj04147]
    AFERRID_20780
Enzymes [BR:afj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     AFERRID_20780
Exosome [BR:afj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFERRID_20780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: BBF65860
UniProt: A0A2Z6IJG0
Position
2000744..2001073
Genome map
AA seq 109 aa AA seqDB search
MDQDLQHAHCVPCEGGVAPLDAERVGLLLRSLPQWQVVGQAIRREFRFKNFYETMAFVNA
VAWISHREDHHPDLELGYNRCVVHYSTHAISGLSENDFICAARVDALLT
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaccaagatcttcaacatgcgcattgcgtaccctgtgagggtggggttgcgcccctg
gacgcggaacgggtaggacttctattacgctccctaccccaatggcaagtggtcgggcag
gcgatccgccgggagtttcgtttcaaaaacttttacgagactatggcctttgtgaatgcc
gtggcatggatctcgcaccgggaggaccatcacccggacctggagctgggttataaccgc
tgtgtcgtccattacagtacccacgccattagcggcctttcagaaaatgacttcatctgc
gccgcccgggtggatgcgctgctgacatga

DBGET integrated database retrieval system