KEGG   Anoxybacillus flavithermus: Aflv_2793
Entry
Aflv_2793         CDS       T00790                                 

Name
(GenBank) Pyruvate-formate lyase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00620  Pyruvate metabolism
afl00640  Propanoate metabolism
afl00650  Butanoate metabolism
afl01100  Metabolic pathways
afl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aflv_2793
   00640 Propanoate metabolism
    Aflv_2793
   00650 Butanoate metabolism
    Aflv_2793
Enzymes [BR:afl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Aflv_2793
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ACJ35146
UniProt: B7GMP4
Position
2778328..2780586
AA seq 752 aa
MALLTVNEALMDAWRTFKGDKWKKEIDVRDFILNNVTVYTGDESFLEGPTEATKKLWEQV
MELSKLERERGGVLNMDTEIVSTITSHGPGYLNKELEKVVGFQTDEPFKRALMPFGGIRM
AEQACEAYGYEVSDEVKKIFTQYRKTHNQGVFDVYTDEMKAARKAGIITGLPDAYGRGRI
IGDYRRVALYGVDRLIEEKKKDLRNTGARTMSEDIIRLREELAEQIRALQELKEMAASYG
YDISKPARNAHEAFQWLYFAYLAAIKEQNGAAMSLGRVSTFLDIYIERDLQEGTLTEREA
QELVDHFVMKLRLVKFARTPEYNELFSGDPTWVTESIGGVAIDGRPLVTKNSFRFLHTLD
NLGPAPEPNLTVLWSTQLPEAFKKYCAKMSIQTSSIQYENDDLMRPEFGDDYGIACCVSA
MRIGKQMQFFGARANLAKALLYAINGGVDEKLKVQIGPEFAPITSEYLDYEEVMRKFDNV
MEWLAELYINTLNVIHYMHDKYCYERIEMALHDTHILRTMATGIAGLSVVADSLSAIKYA
KVKTIRDENGLAVDFEIEGDFPKYGNNDDRVDAIAVDIVERFMTKLRKHKTYRDSKHTTS
ILTITSNVVYGKKTGNTPDGRRAGEPFAPGANPLHGRDTKGALASLSSVAKLPYEYALDG
ISNTFSIVPKALGKDDATRIQNLVAILDGYALKRGHHLNVNVFNRETLLDAMEHPEKYPQ
LTIRVSGYAVNFIKLTREQQIDVINRTFHETM
NT seq 2259 nt   +upstreamnt  +downstreamnt
atggcgctacttactgtgaacgaagctttaatggacgcttggagaacgttcaaaggcgat
aagtggaaaaaagaaattgatgttcgcgattttattttaaataacgtaaccgtttacaca
ggggatgaatcgtttctagaaggtccaacggaagcgacgaaaaagctttgggaacaagtg
atggaactttccaaactagaacgcgaaagaggcggcgttctcaacatggatacagaaatc
gtatcaaccattacatcgcatggacctggctatttgaataaagagcttgaaaaagttgtt
ggttttcaaacagacgaaccgtttaaacgggcgcttatgccatttggcggtattcgcatg
gcggagcaagcatgcgaagcttacggatatgaagtaagcgatgaagtaaagaaaattttt
acgcaatatcgtaaaacgcataaccaaggcgtatttgacgtatataccgatgaaatgaaa
gcagcgcgcaaagcaggaattattacaggacttcctgacgcctatggacgcggtcgcatt
atcggtgactaccgccgcgtcgcgttatacggtgtcgatcgcttaattgaagaaaagaaa
aaagatttacgcaacacaggcgcgcgtacaatgagcgaagacatcattcgtcttcgtgaa
gaattagcggaacaaattcgcgctcttcaagaattaaaagaaatggcggcaagctacggc
tacgatatttccaaaccagcacgcaacgcacacgaagcgttccaatggttatatttcgct
tatcttgcggcgattaaagaacaaaacggtgcggcaatgagcttaggtcgcgtctcaaca
tttttagatatttatattgaacgcgacttacaagaaggcacattaacagaacgcgaagca
caagagcttgttgaccatttcgtcatgaaattgcgtctcgtcaaattcgcaagaacgcca
gaatacaatgagctatttagcggcgacccaacgtgggtcacagagtccattggcggtgtc
gcgattgacggtcgtccgcttgtgacgaaaaactcattccgcttcttgcatacgcttgat
aacttaggcccggcgccagaaccaaacttaacggtgctttggtcgacacaattgccagaa
gcgtttaagaaatattgcgcgaaaatgtcgattcaaacaagctccattcaatatgaaaat
gacgatttaatgcgtccggagtttggagatgactacggtatcgcatgctgcgtctccgcg
atgcgcatcggtaaacaaatgcagttttttggcgcgcgcgcaaaccttgcgaaagcgtta
ttatacgcgattaacggcggcgttgacgaaaaactaaaagtgcaaatcggtccagaattt
gcgccaatcacatctgaatacttagactacgaagaagtaatgcgcaaatttgacaacgtc
atggaatggctagcagaattgtatattaatacgttaaacgtcatccattacatgcatgat
aaatattgttatgaacgcatcgaaatggcgcttcacgatacgcacattttgcgtacaatg
gcaactggcatcgctggattgtccgttgtcgctgactcattaagtgcaattaaatatgca
aaagtaaaaacaattcgcgatgaaaacggcttagctgtcgactttgaaatcgaaggcgac
ttcccgaaatacggaaacaacgacgatcgcgttgatgcgattgctgtcgatattgttgaa
cgttttatgacaaaattgcgcaaacataaaacgtatcgcgactcgaaacatacgacgtcg
attttaacgatcacatcaaacgtcgtatacggtaaaaagacaggaaatacaccagatggt
cgtcgcgctggcgaaccgttcgcaccgggcgctaacccgttgcacggtcgcgacacaaaa
ggagcgcttgcgtcattaagctctgtcgcaaaattaccgtatgaatatgcattggacggc
atttcaaatacgttctcaatcgtgccaaaagcgctcggtaaagatgacgcgacacgcatt
caaaaccttgtcgccattttagatggttatgcactaaaacgcggtcatcacttgaacgtc
aacgtctttaaccgcgaaacgttgctcgacgcgatggaacatcctgaaaaatatccgcaa
ctaacgattcgcgtatcaggttatgcggtcaactttattaaattaacacgtgaacaacaa
attgacgtcattaatcggacgttccatgaaacaatgtaa

DBGET integrated database retrieval system