KEGG   Anoxybacillus flavithermus: Aflv_0133Help
Entry
Aflv_0133         CDS       T00790                                 

Gene name
rplQ
Definition
(GenBank) Ribosomal protein L17
  KO
K02879  large subunit ribosomal protein L17
Organism
afl  Anoxybacillus flavithermus
Pathway
afl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:afl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Aflv_0133 (rplQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:afl03011]
    Aflv_0133 (rplQ)
Ribosome [BR:afl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Aflv_0133 (rplQ)
  Bacteria
    Aflv_0133 (rplQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L17 DUF3306
Motif
Other DBs
NCBI-ProteinID: ACJ32517
UniProt: B7GJ95
Position
134855..135217
Genome map
AA seq 120 aa AA seqDB search
MSYRKLGRTSSQRKALLRDLVTDLIINERIETTEARAKELRSVVEKMITLGKRGDLHARR
QAAAFVRKEVANTETGQDAIQKLFSDIAPRYQDRQGGYTRIMKLGPRRGDGAPMVIIELV
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacagaaaattaggacgcacaagctctcaacgtaaagcgttgcttcgtgactta
gtgacagacttaatcattaatgagcgaattgaaacaacagaagctcgtgcaaaagagttg
cgttctgttgtagaaaaaatgattacattaggaaagcgcggcgatttgcatgcacgtcgt
caagcggctgcattcgtacgcaaagaagtcgcaaacacagaaacaggtcaagatgcgatt
caaaaattgtttagcgacatcgcacctcgttaccaagaccgtcaaggtggttatacgcgc
attatgaaacttggaccacgccgtggtgacggtgcgccaatggttattattgaactagtt
taa

DBGET integrated database retrieval system