KEGG   Anoxybacillus flavithermus: Aflv_0413Help
Entry
Aflv_0413         CDS       T00790                                 

Gene name
pckA
Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00010  Glycolysis / Gluconeogenesis
afl00020  Citrate cycle (TCA cycle)
afl00620  Pyruvate metabolism
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01120  Microbial metabolism in diverse environments
afl01130  Biosynthesis of antibiotics
afl01200  Carbon metabolism
Module
afl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:afl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aflv_0413 (pckA)
   00020 Citrate cycle (TCA cycle)
    Aflv_0413 (pckA)
   00620 Pyruvate metabolism
    Aflv_0413 (pckA)
Enzymes [BR:afl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Aflv_0413 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: ACJ32797
UniProt: B7GK41
Position
complement(449375..451045)
Genome map
AA seq 556 aa AA seqDB search
MHELVWTIYQNVLYFLHKDKSNKGRFCPMNSIELTNKLSTLLQRDGVFHNLSVPRLVEKV
LTRKEGILTSSGAICATTGKYTGRSPKDKYIVEEPSVKHKIDWGTVNQPISKEVFDKLYN
KVIDYLMKKEELFVFNGFAGADPAYRLPIQVVNEFAWHNLFAHQLFIRPTAEELQAHEPR
FTVISAPTFKADPSIDGTRSETFIIISFERRTVLIGGTEYAGEMKKSIFSVMNFLLPEQG
IFPMHCSANVGQEGDVALFFGLSGTGKTTLSADPNRRLIGDDEHGWSNNGVFNIEGGCYA
KCINLSREKEPQIFDAIRFGSVLENVIVDPDTRIPNYDDATLTENTRAAYPLEAMDNIVQ
PSVAGHPHTIVFLTADAFGVLPPISKLTKEQAMYHFLSGYTSKLAGTERGVTAPEATFST
CFGSPFLPLPATRYADMLGQKIDAHGVQVFLVNTGWTGGGYGVGERMKLSYTRAMVKAAL
EGELNNVETVQDTIFGLHIPLHVPGVPDEVLQPKSTWADQEAYEQKAKELAAKFRENFKK
FTNVDPRIEKLGGPIA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaattagtatggactatttatcaaaatgtgttatactttttacataaagataaa
tcaaacaaaggtaggttttgtccaatgaattccattgaactgacaaacaaattatcaacg
ctcttacaaagggatggggtttttcataacttatctgtaccacgactagtagaaaaagta
ctaactcggaaagaaggcatcctaacttcatcaggagcgatttgtgcaacaactggaaaa
tatacaggccgttctccaaaggataaatatattgtcgaagaaccgtctgtgaaacataaa
attgattggggaactgtcaatcaacctatttctaaagaggtatttgataagctttacaac
aaagtgatcgattatttaatgaaaaaagaagaactatttgtatttaatggctttgcaggc
gcagatccagcttatcgtttgccgattcaagtggtcaacgaatttgcttggcataactta
tttgctcatcaattgttcattcgtccaacagcggaagaattacaagcacatgaaccacga
tttacagtcatttctgcaccaacatttaaagctgatccatctattgacggcacgcgctca
gaaacgtttattatcatctcattcgagcgccgcactgtactaattggtggaacagaatat
gctggtgaaatgaaaaaatccattttctctgtcatgaactttttattgccagaacaagga
atcttcccgatgcactgttcagcaaacgtaggtcaagaaggtgatgtcgcgctctttttc
ggtttatctggtacaggaaaaacaacgctttctgccgatccaaaccgtcgcctaattggc
gatgacgagcacggttggtcaaacaacggtgtttttaatattgaaggtggatgttatgcc
aaatgcattaacttatcacgtgaaaaagagccacaaatttttgatgcgattcgcttcggc
tctgtattagaaaacgtcatcgttgacccagacacgcgcataccaaactatgacgatgca
acattaacggaaaatacgcgcgcagcatatccgctcgaagcgatggataatatcgtgcag
ccgagcgttgctggccatccgcatacaatcgtttttttaacagcagatgcgttcggcgta
ttgccaccaattagtaaattaacgaaagaacaagccatgtaccatttcttaagcggctat
acgagcaaattagcgggcacagaacgcggagtgacagcgccggaagcaacattttctaca
tgcttcggttcaccgtttttaccgcttcctgcaacgcgttacgcagacatgcttggtcaa
aaaattgacgcccacggtgttcaagtgtttttagtaaacaccggttggactggtggtgga
tacggcgttggtgaacgaatgaagctgtcgtatacacgcgcgatggtaaaagcagcgtta
gaaggagaattaaacaacgtagaaaccgttcaagatactattttcggtcttcatatcccg
cttcacgttcccggtgtgcctgatgaagtgttacaaccgaaaagcacatgggcagatcag
gaagcatatgaacaaaaagcaaaagagctcgcagcgaagttccgggaaaactttaaaaaa
ttcacaaacgttgatccacgcatcgaaaaactcggtgggccaatcgcataa

DBGET integrated database retrieval system