KEGG   Anoxybacillus flavithermus: Aflv_1105Help
Entry
Aflv_1105         CDS       T00790                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00260  Glycine, serine and threonine metabolism
afl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01130  Biosynthesis of antibiotics
afl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aflv_1105 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aflv_1105 (trpB)
Enzymes [BR:afl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Aflv_1105 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACJ33481
UniProt: B7GHQ9
Position
1095234..1096430
Genome map
AA seq 398 aa AA seqDB search
MLTLPNERGRFGMFGGKFVPETLMRPLADIERQLYEALADPSFHAEYMHHLYEYSGRPTA
LTFAKNLTERLGGAKMYFKREDLNHTGAHKINNAIGQALLAKRMGKRKIIAETGAGQHGV
AAATVAARFGMECKVFMGEEDVKRQSLNVFRMKLLGAEVIPVTSGNRTLKDATNEAIRYW
VEHCDDHFYMIGSVVGPHPYPMMVREFQRIIGEEAREQMLKAEGKLPNTIIACVGGGSNA
IGMFHPFLDDDVECIGVEAAGKGVHTTEHAATITKGTKGVIHGSLTYVLQDEHGQIVEPY
SISAGLDYPGVGPEHAYLAHIGRVRYESVTDEEAIAALQMTAETEGIIPAIESAHALAKA
FQIAPLRSKHETILVCLSGRGDKDVQTVMNYLEGDERK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgttgacattgccaaatgaacgcggtcgctttggtatgtttggtggaaagtttgtgcca
gaaacattaatgcgtccgttagctgatatagagcgccaattgtatgaagcattggccgat
ccttcgttccatgcggaatatatgcatcatttgtatgaatattcaggtcgtccgaccgcc
ttaacatttgcaaaaaacttgacagaacgattaggcggggcgaaaatgtactttaaacgt
gaagacttaaaccatacaggtgcccataaaataaacaacgcgatcgggcaagcgttgtta
gcaaaacgaatgggaaaacgaaaaattatcgctgaaacaggtgcaggacagcacggcgta
gccgcagcgaccgtcgccgctcgttttgggatggaatgcaaagtatttatgggtgaggaa
gatgtgaaacggcagtcattaaacgtatttcgtatgaaactgcttggtgcagaagtcatt
ccagtcacaagcggcaatcgtacattaaaagacgcaacaaatgaagcgattcgttattgg
gtggagcattgtgacgaccatttttacatgattggttccgtcgttggcccgcatccatat
ccgatgatggtgcgtgaatttcaacgtattatcggcgaagaagcgcgcgaacaaatgtta
aaagcagaaggaaaactgccgaacacaatcattgcttgtgttggtggcggaagtaatgcg
atcggaatgttccatccatttttagatgatgatgttgaatgtattggtgttgaggcagct
ggaaaaggtgtgcatacgacggagcatgctgcaacgataacaaaaggaacaaaaggtgtc
attcatggttccctcacatacgtattgcaagatgagcacggtcaaattgtggagccgtat
tcgatttcagctggtttagattatccaggtgttggaccagagcatgcatatttagcacat
attggacgcgttcgctatgagagtgtaacggacgaggaagcgattgcagcacttcaaatg
actgcagaaacagagggaatcattccagcaatcgaatctgcgcatgcgctcgccaaagcg
tttcaaatcgccccccttcgttcaaaacatgaaacgattctcgtttgtttatcaggaaga
ggcgataaagatgtacaaacggtgatgaactatttggaaggggatgaacggaaatga

DBGET integrated database retrieval system