KEGG   Anoxybacillus flavithermus: Aflv_1473Help
Entry
Aflv_1473         CDS       T00790                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00860  Porphyrin and chlorophyll metabolism
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Aflv_1473
Enzymes [BR:afl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Aflv_1473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACJ33839
UniProt: B7GI57
Position
complement(1477478..1478368)
Genome map
AA seq 296 aa AA seqDB search
MFYVMFLQILRNFASLCGMMGRKGDERMGEKALTNKKIALCASRKIEEMSMLIAKQGGIP
LSRPAQGTMFCNEELEQQLHQMINEPVDWFIFTTGIGAETLIKKADEWGMKDALLQVIRR
AHIAVRGYKTVNVLRAYGISPHITANDGTTRGLIRALGDVEWKNKHVVVQLYGDSVPSLQ
QFLVKQGALYKEVWPYLHTPPTPSVMKQLIDEIISRSVQAVCFTSAIQVRFFFSVVNEWG
YIREMKRALADDVVAVAVGKVTKEALHEEGVARVIAPDHERMGAMIVELAKYFEKK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgttttatgtcatgtttctacaaattttgcgcaatttcgcatctttatgtggtatgatg
ggaagaaaaggagatgagagaatgggtgagaaagcgttaacgaataaaaaaattgcacta
tgtgcctcgcgtaaaatagaggaaatgagcatgcttatcgctaaacaaggagggattcct
ctttctcgacctgcccaaggaacgatgttttgcaatgaagagctagagcaacagcttcat
caaatgatcaatgaaccagtcgattggtttattttcacaacaggaattggtgccgaaacg
ttaataaaaaaagcagacgaatggggaatgaaagatgcgttacttcaggtcattcgccga
gcacatatagcggtacggggttataaaacagtaaatgtgttacgtgcgtatggtatcagt
ccgcacataacggcaaatgatggaacgacacgtggccttatacgtgctttgggagatgtc
gaatggaaaaacaaacatgtggttgttcagctttacggagattctgttccatccttacaa
caatttttagttaaacaaggggctttgtacaaagaagtatggccatatcttcatactcca
cctacaccaagtgtgatgaaacagcttattgatgaaatcatctctcgatctgtacaagcg
gtttgttttacatcagcaattcaagtgcgttttttcttttcggttgtgaatgaatgggga
tacatacgtgaaatgaaacgagcgttggccgatgacgttgtagctgttgcggttgggaag
gtgacaaaagaagcgttacatgaagaaggggttgcacgtgtcattgcaccagatcacgaa
cgtatgggggccatgattgtcgaactcgcaaaatattttgagaaaaagtag

DBGET integrated database retrieval system