KEGG   Anoxybacillus flavithermus: Aflv_1703Help
Entry
Aflv_1703         CDS       T00790                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00900  Terpenoid backbone biosynthesis
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01130  Biosynthesis of antibiotics
Module
afl_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Aflv_1703 (dxr)
Enzymes [BR:afl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Aflv_1703 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Sacchrp_dh_NADP DUF2608 potato_inhibit
Motif
Other DBs
NCBI-ProteinID: ACJ34064
UniProt: B7GG83
Position
complement(1700261..1701415)
Genome map
AA seq 384 aa AA seqDB search
MNSLRAISLLGATGSIGMQTLDVIRAHPDAFRLVAFSAGRNIEQARHIIEQFSPNIVCVA
QKEDAERLQSEYKGRVRIAFGEDGLIEVATVQEADIVVNAVVGSVGLVPTLKAIEAKKTI
ALANKETLVTAGHLVMKHAADYGVTILPVDSEHSAIFQCLQGEQQKNIEYIILTASGGSF
RDRTREQLQHVTVEEALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFHLPYEQIDVLL
HKESIIHSMVQFHDGSVIAQLGTPDMRVPIQYALTYPDRFPLHIERLNLAQVATLHFQKV
DMDRFRCLQFAYEAGKIGGTMPTVLNAANEEAVSAFLTGRISFLAIEQYIEQAMNWHVPI
AHPDLETIRTVDRETRQYVKSLYM
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagtttgcgagcaattagtttattaggagcgactggctcgatcggcatgcaaacg
ttagatgtcattcgcgctcatcccgatgcgttccgtctcgttgctttttcagccggacga
aacatcgagcaggctcgacatattattgagcaattttcaccaaacatcgtatgcgtggcg
caaaaagaagatgccgaacggttacaaagcgaatataagggacgagtgcgtatcgctttc
ggtgaagatggcctcattgaagtggcgacagttcaagaagcggacattgttgtcaacgca
gttgttgggagcgttgggctagttcctacgttaaaggcgattgaggcgaaaaaaacgatt
gcgttagcgaataaagaaacgttagttaccgcaggtcatcttgtcatgaaacacgctgcc
gattatggcgtaacgattttgccggttgatagtgagcattctgctatttttcaatgtttg
caaggggaacaacaaaaaaatatcgaatatattattttgacggcatctggtgggagtttt
cgcgatcggacgcgcgaacaactacagcatgttacggtggaagaggcgttaaaacatcca
aattggtcgatgggagcgaaaattacaattgattctgcaacgatgatgaacaaaggactc
gaagtgatcgaagcacactggttgttccacttaccgtatgaacaaattgacgtgctgtta
cataaagaaagcattattcattcgatggtgcaatttcacgacggaagtgtcatcgctcaa
ctaggaacgccagatatgcgcgtaccgattcaatatgcattaacataccctgaccgtttt
ccgctacatattgaacggctaaacttagcacaagtagccacgttgcactttcaaaaagtg
gacatggaccgattccgttgtttacaatttgcttatgaagcaggaaaaatcggcggaacg
atgccgaccgtattaaatgcggccaacgaagaagcggtgtcggcctttttaactggacga
atatcgtttttagcgattgaacaatacattgaacaagcaatgaattggcacgtaccgatc
gctcatccggatcttgaaacgattcgtacagttgatcgcgaaacgcgacaatatgtaaaa
tcactatacatgtaa

DBGET integrated database retrieval system