KEGG   Anoxybacillus flavithermus: Aflv_1753Help
Entry
Aflv_1753         CDS       T00790                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00020  Citrate cycle (TCA cycle)
afl00640  Propanoate metabolism
afl00660  C5-Branched dibasic acid metabolism
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01120  Microbial metabolism in diverse environments
afl01130  Biosynthesis of antibiotics
afl01200  Carbon metabolism
Module
afl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aflv_1753 (sucC)
   00640 Propanoate metabolism
    Aflv_1753 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Aflv_1753 (sucC)
Enzymes [BR:afl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Aflv_1753 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACJ34114
UniProt: B7GGD2
Position
complement(1743259..1744464)
Genome map
AA seq 401 aa AA seqDB search
MKALVLLFLYIGGWGMNIHEYQGKEILRSYGVSVPNGRVAFTVEEAVEAAKELGSSVCVV
KAQIHAGGRGKAGGVKVAKSLDEVRTYASELLGKVLVTHQTGPEGKEVKRLLIEEGCDIK
KEYYIGLVVDRATSRVVLMGSEEGGTEIEEVAAKTPEKIFKEYIDPAVGLQAFQARRMAF
NINIPKELVNQAVKFMLGLYQVFVEKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYR
HKDILEYRDLDEEDPKEVEASKYDLNYISLDGNIGCMVNGAGLAMATMDIIKYYGGEPAN
FLDVGGGATTEKVTEAFKIILSDPNVKGIFVNIFGGIMKCDVIANGIVEATKQVGLNLPL
VVRLEGTNVELGKKILEESGLNITAAESMADGAQKIVSLVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctagtacttttatttttatacataggaggatggggtatgaatattcatgag
tatcaaggaaaagagatcctcagaagctacggagtgagcgtgccgaacggccgtgtggcg
ttcacggttgaagaagcagttgaggcggcgaaagagctcggcagtagcgtttgtgtcgtg
aaagcgcaaattcatgccggcggtcgcggaaaagcagggggagtaaaagtcgcaaaaagt
ttagacgaagttcgtacatatgcgagtgagctgttaggaaaagtgcttgtcacacatcaa
acaggtccagaaggaaaagaagtaaagcgtcttttaatcgaagaaggatgcgacattaaa
aaagaatattacatcgggcttgttgttgatcgtgcgacatcccgcgttgttttaatggga
tcagaagaaggcggaacagaaatcgaagaagtcgcagcgaaaacgccagagaaaattttt
aaagagtacatcgacccagctgtcggcttacaagcatttcaagcgcgtcgtatggcgttt
aacatcaacattccaaaagagctcgtcaaccaagcagtcaaatttatgttagggttatac
caagtattcgttgaaaaagattgttcgattgctgaaattaacccgcttgtcgtgactggc
gacggaaaagtgatggcgcttgatgcaaagcttaacttcgattcgaacgcgctatatcgt
cataaagacattttagaataccgcgatttagacgaagaagatccaaaagaagtggaagcg
tcaaaatacgacttaaactacatttcgcttgacggaaacattggctgcatggtaaacggt
gcgggcttagcgatggcaaccatggacattattaaatattatggcggcgagccagcaaac
tttttagacgttggtggcggtgcgacgacagagaaagtaacagaagcgtttaaaatcatt
ttatccgacccgaacgtcaaaggcattttcgttaacatttttggcggcattatgaaatgt
gacgtcatcgcaaacggcattgttgaagcgacgaagcaagtcggcttaaaccttccgctt
gtcgttcgtttagaaggaacgaacgtcgaattagggaaaaagattttagaggaatccgga
ctaaacattacagcggctgaatcgatggcggacggcgcgcaaaaaatcgtttcgttagta
agctaa

DBGET integrated database retrieval system