KEGG   Anoxybacillus flavithermus: Aflv_1795Help
Entry
Aflv_1795         CDS       T00790                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00230  Purine metabolism
afl01100  Metabolic pathways
Module
afl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Aflv_1795
Enzymes [BR:afl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Aflv_1795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 ABC_tran MMR_HSR1 RsgA_GTPase AAA AAA_16 Rad17 AAA_33
Motif
Other DBs
NCBI-ProteinID: ACJ34156
UniProt: B7GGA5
Position
complement(1782252..1782866)
Genome map
AA seq 204 aa AA seqDB search
MKERGLLIVLSGPSGVGKGTVRKALFSQPDIQLQYSISVTTRKPREGEVDGVDYFFKTRE
QFEKMIRENELLEWAEYVGNYYGTPIAYVEKTLQEGKDVFLEIEVQGAMQVRKVFPEALF
IFLAPPSLSELRKRIEMRGTESEELIRDRLKAAKEELEMMDAYDYVVENDQVELACERIK
AIVMAEHCRRERVAQRYKKMLEVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagagcgaggtttattaatcgttttatcaggaccgtccggcgtaggaaaagggacg
gtacgtaaagctttattttcacagccggatattcaattacaatattcgatttccgtcaca
acgcgcaaaccgcgcgaaggagaagtggatggtgtagattactttttcaaaacacgtgaa
cagtttgaaaaaatgattcgtgaaaatgagttgttagaatgggcggaatatgttgggaat
tactacggcacgccaattgcgtacgtagaaaaaacgttgcaagaaggaaaagacgtcttt
ttagaaattgaagtgcaaggggcgatgcaagttcgtaaagtgttcccagaggcgctcttt
attttcttagctccgccaagtttaagcgaactgcgcaaacgaatcgaaatgcgcggaaca
gaatcagaagaacttattcgtgatcggttaaaggcggcaaaagaagagctagagatgatg
gatgcgtacgattacgtcgtcgagaacgaccaagttgagcttgcgtgtgaacgcattaaa
gcgattgtgatggcagagcattgccgacgcgaacgcgtcgcacaacgatacaaaaagatg
ttggaggttgagtaa

DBGET integrated database retrieval system