KEGG   Antarcticibacterium flavum: FHG64_01915Help
Entry
FHG64_01915       CDS       T06005                                 

Definition
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
afla  Antarcticibacterium flavum
Pathway
afla00260  Glycine, serine and threonine metabolism
afla01100  Metabolic pathways
afla01110  Biosynthesis of secondary metabolites
afla01120  Microbial metabolism in diverse environments
afla01130  Biosynthesis of antibiotics
afla01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FHG64_01915
Enzymes [BR:afla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FHG64_01915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_3 Cys_Met_Meta_PP Pyridoxal_deC DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: QCY68254
Position
complement(415122..416150)
Genome map
AA seq 342 aa AA seqDB search
MKEIDLRSDTVTKPTKGMLEAIMNAEVGDDVYKEDPTVNALEEKLARMFGKEEALFFPTG
SMANQAAIKLHTQPADQLICDKWAHVYNYEGGGASFNSGVSCKLVDGDRGMITARQVEEN
INPPDFYHSPLTTLVCLENTTNKGGGACYDFEEIRKIRKVCDEHGLGLHLDGARLVNALV
AKKEDPKDYGKIFDTISICLSKGLGTPIGTVLVGDKEIMKNAMRVRKVLGGGMRQVGFMA
AAGIYALDNHMERLADDHRRASELGQTLKKQEFIGEVEPVETNIVIFYLKNPKNEAAFME
QLKQQNIRISNMGQGKLRIVTHLDYSEEMHQRFLEVLKNIRL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatagacttaagaagtgataccgtaacgaaacctaccaaaggaatgctggag
gctattatgaatgccgaagttggagatgacgtatacaaagaggaccctacggtaaatgcc
ctggaggagaaactggcgaggatgttcggaaaagaagaagcgctgttcttccctaccggg
agtatggccaaccaggcggcgataaaactgcacacccagcctgcagatcagctaatttgt
gataaatgggcccatgtttacaattatgagggaggaggggcttcctttaacagcggggtt
tcctgtaaactcgtcgatggagacagggggatgataaccgcgcggcaggtggaggaaaat
atcaatccgccagatttttatcacagtccgctaaccacgcttgtgtgccttgagaatacc
actaataagggagggggagcctgttacgattttgaggaaataagaaagataagaaaggtt
tgtgatgagcacgggcttgggctacacctggatggtgcccggctggtaaatgccctggtt
gcgaaaaaggaggatcccaaagactacggaaagatatttgacactatttccatttgtcta
tctaaaggtcttgggacacctataggaactgtattagtaggggataaggaaattatgaaa
aacgctatgagggtacgtaaagttcttggaggtggaatgagacaggtaggtttcatggcc
gctgcaggtatatacgcactcgataatcacatggagcggctggcagatgatcatagaaga
gcttcagaacttggacaaacacttaagaagcaggaatttattggggaggtagagccagtg
gaaaccaacatcgtgatcttctacctcaagaaccctaaaaatgaagctgcctttatggaa
cagctaaagcagcagaatataagaataagcaatatgggccagggtaaattgaggattgtg
acccacctggattattcagaagaaatgcaccaacgatttctggaagtgcttaaaaatatt
cggctgtaa

DBGET integrated database retrieval system