KEGG   Antarcticibacterium flavum: FHG64_18985Help
Entry
FHG64_18985       CDS       T06005                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
afla  Antarcticibacterium flavum
Pathway
afla00430  Taurine and hypotaurine metabolism
afla00620  Pyruvate metabolism
afla00640  Propanoate metabolism
afla00680  Methane metabolism
afla01100  Metabolic pathways
afla01120  Microbial metabolism in diverse environments
afla01200  Carbon metabolism
Module
afla_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:afla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FHG64_18985
   00640 Propanoate metabolism
    FHG64_18985
  09102 Energy metabolism
   00680 Methane metabolism
    FHG64_18985
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    FHG64_18985
Enzymes [BR:afla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     FHG64_18985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: QCY71310
UniProt: A0A5B7WXR1
Position
complement(4338205..4339392)
Genome map
AA seq 395 aa AA seqDB search
MNKILIINSGSSSLKFQLIAMPAEEVLASGLVERIGQENSMLHYKSGDFKTSEEFSIPDH
SVALKKVTNYLLDPEKGVIKDASEIPAIGHRVVHGGDAFSETIEIDEEVKSEIKKLFSLA
PLHNPPNLKGIQVAEDIFPEAKQVAVFDTAFHRSIPDCANTYAIPLSFKQDHNIQVYGFH
GTSHKYVTEQAIEMLDKKNSKIISVHLGNGCSITAVQDGKSVDHSLGFGPVNGLIMGTRS
GDIDQSIIFYMIEKLGYSAREVSDLLHHKSGMLGLTGYSDLRDIEAEAEKGNRKCQLALE
MNAYRIKKYIGAYTAAMNGLDAIVFTAGIGENSDILRSLVCKDMEYLGIEIDPEKNVIRS
KENRAINRENARVKVLIIPTNEELEIAKQTYKLVF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatacttattataaattccggtagttcctccttaaaatttcagcttattgca
atgcctgctgaagaagtactggcctcagggctggtagagagaataggacaggaaaattca
atgttgcattataaatctggtgattttaagacttctgaagaattttcaatccccgatcat
tctgtagccttaaaaaaggtaacaaattatttactggatcctgaaaagggtgttattaag
gatgcttcagaaattcccgcaattgggcacagagtggttcatggtggagatgctttttcg
gaaaccattgagatcgatgaggaggtgaaatctgaaattaaaaagcttttttccctcgcc
ccgctccataatccgccaaaccttaaagggatccaggtcgctgaggatatttttcctgaa
gctaaacaggtagctgtttttgatactgcctttcaccgctccattccagattgtgccaat
acttatgccattcccctgtcctttaaacaggatcataatatccaggtatacggttttcac
ggtaccagtcataaatatgtgacagagcaggcaatcgaaatgctggataagaaaaattca
aagatcataagcgtgcacctgggcaatggctgtagtattactgctgtgcaggacggcaaa
agcgtagatcattcccttggttttggaccggtgaatggcctaatcatgggtacccggagc
ggtgatattgaccagtccattattttttatatgattgaaaaactgggatattcagctaga
gaggtaagcgacttgcttcatcacaaaagtgggatgttgggacttaccggctacagcgat
cttcgggacattgaggcagaagcagaaaaaggtaaccgcaagtgccagcttgcactggag
atgaatgcctacaggatcaaaaaatatataggtgcttatactgccgctatgaatggcctg
gatgcgattgttttcacagcggggattggtgagaatagtgacatacttcgctccctggtt
tgtaaagacatggagtacctgggtatcgagatcgatcccgaaaagaatgtaattcgatca
aaagagaatagagcgatcaatcgagaaaatgcaagggtaaaagtgctaattattcccacc
aatgaagaacttgaaatagccaaacaaacatataaactggttttttaa

DBGET integrated database retrieval system