KEGG   Aspergillus fumigatus: AFUA_1G00450Help
Entry
AFUA_1G00450      CDS       T01017                                 

Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase (NagA), putative
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
afm  Aspergillus fumigatus
Pathway
afm00520  Amino sugar and nucleotide sugar metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFUA_1G00450
Enzymes [BR:afm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     AFUA_1G00450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 3507501
NCBI-ProteinID: XP_749797
UniProt: Q4WL23
Position
1
AA seq 430 aa AA seqDB search
MPGKTTTTPRITKFTNCRIVKGSELVEQDVWIDSLSGKILKDQEAFYGLHLSPDEVVDLG
GRILAPGLIDVQLNGAQGFDFSVPQASKEEYNEGLRLVNKGLARTGVTSYLPTVVSSTPE
VYWKVLPSLGPSGSNHRPEDGAESLGAHVEGPFINLNRNGIHKTEVLRAAQNFEDLEECY
GKENLTGSSKSVKMITVAPEVGNMVSTIPSLTSAGIVCSIGHSDATFEQALSATTAGATM
VTHMFNAMRPFYHRNPGIFGLLGQSEHYRPFYSIIADGIHLHPTSIKIAYNAHPDGLVLV
TDAMKLCGLPDGVYDWMNGERIIKTGACLTLEGSDKIAGSSATLIECINNFRRWSGASIA
DAINAATATPARLLGLQGVKGSLDSGADADLVVLSEEDDPESPTLTVCQVWKRGVKIHDS
DKEIASTTTV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcaaaacaacgactactccgcgtatcaccaaattcactaactgtcgcatcgtc
aagggttccgagcttgttgagcaggatgtctggatcgattctctgtcgggcaagatcctc
aaagatcaggaagctttctatgggttacatctttcgccagatgaggtcgtcgacctcggc
gggcgtattctcgctccgggattgatcgatgtccagctaaatggcgctcaaggttttgac
ttctctgtgcctcaagcgtccaaggaggaatataatgagggtttgcgcttggtgaacaaa
ggccttgccaggaccggggtgacttcatacttgcctactgttgtcagctcaaccccagag
gtttactggaaggtattgccctctttgggcccttcgggcagcaaccatcgtcctgaggat
ggcgcggaatcattaggagcccatgtcgaagggcctttcatcaacctaaatcgcaatggc
attcacaagaccgaggtgcttcgtgctgcgcaaaatttcgaggatctagaggagtgttat
ggcaaagagaatctcaccggaagctctaagtcagtcaaaatgatcacagtcgcccccgag
gtgggaaacatggtatcgaccatcccctcattgacctcggccggcatcgtctgctccatc
ggtcactcggatgcgacattcgaacaagcgctctcagcgaccactgcgggcgctacaatg
gtcacgcatatgttcaatgcgatgcggcccttctaccaccgaaacccgggcattttcgga
ctgctgggccagagcgaacattacaggcccttctacagcatcatcgccgacggtatccat
ctgcacccaacctcgatcaaaatcgcatacaacgcccatccggacgggctcgtcctcgtg
accgacgcaatgaagctctgcggccttcccgacggtgtctatgactggatgaacggcgag
cgcattatcaagacgggagcctgcttgaccctggagggatccgacaagatcgcaggtagt
tcggccaccctgatcgagtgcatcaacaacttccggcgctggtctggcgcctctatagct
gatgccattaacgctgccacggcgactccggcgcgcttattggggttacaaggcgtcaag
ggttccctggatagcggcgccgacgcggaccttgtcgtgctgagcgaggaagacgaccct
gagtcgcccacgctaactgtctgccaggtgtggaaacggggagtcaagatccatgactct
gataaagaaatagcgtctacaactacagtatga

DBGET integrated database retrieval system