KEGG   Aspergillus fumigatus: AFUA_1G03150
Entry
AFUA_1G03150      CDS       T01017                                 

Definition
(RefSeq) c-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
afm  Aspergillus fumigatus
Pathway
afm00100  Steroid biosynthesis
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
Module
afm_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    AFUA_1G03150
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     AFUA_1G03150
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 Ferlin_C
Other DBs
NCBI-GeneID: 3507893
NCBI-ProteinID: XP_750065
UniProt: Q4WKA5
Position
1
AA seq 498 aa
MAPRKDFEDKATVPIQPVPGKRGYEFGGPLGAFVFIFGLSTLIYCLTFLCNDVSGCPVPS
LLNPSTLSLDKLKEEAGWPQEGLKAFFDVRVTVWVLSYYVLSLVLYVFLPGEVVEGTELA
CKGRLRYKFNALPSAILILGGLALGTYMHGADFVVWTFLWDNYVQIITANLIICVVLAIF
VYARSFSIPAPGQPNPELRELAPGGHSGNALYDFFIGRELNPRVQLPIPFVDEASRTIDI
NVWCEMRPGLLGWIILNLSNIARQYRTYGYITNSIVLSTVFQTFYVLDALYMEPAVLTTM
DVIMDGFGYMLSFGHLVWVPFIYNIQTRYLAVFPLELRLREILLILAVTGAGYAIFRGAN
NQKNRFRRDPSDPRMMHIKYIQTSSGSKLMISGWWGLARHINYLGDWLMSWSYSLPTGIA
GYTIIESINSSGDMQKQAIQTPEVRGWGMIFTYFFLVYFGALLIHREGRDEEKCKSKYGT
DWERYTSIVRSRIIPGIY
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggcaccaagaaaggatttcgaagacaaggctacggttccaatacagccagttccagga
aaacggggctatgagtttgggggccctctcggcgcgtttgtattcatttttggtctctca
actcttatctactgcctcaccttcctgtgtaacgatgtgtcaggctgtcctgttccgtcg
ctgctgaatccatcgacattgtccctagacaagctgaaggaggaggctggctggccacaa
gaaggcctcaaagcgttctttgacgttcgggtgaccgtgtgggtgctgagttattacgta
ctcagtctggttctgtacgtatttctaccaggtgaggtggtggagggcacggaattggcc
tgcaagggaaggcttcgctacaagttcaatgcccttccttccgccattctgatcctcggt
ggtttagccctgggcacatacatgcacggtgctgacttcgtcgtatggacttttctctgg
gataactacgtgcagatcattacggcaaacttgataatttgcgtagtcctcgccatcttt
gtgtatgcgagaagtttctccatccctgcacctggtcaacccaacccggagctgagagaa
ttggcaccaggtggtcactctggaaatgctctgtatgattttttcattggtcgggagctt
aatcctcgggtgcagttgcccattccctttgttgatgaggcctcacgaacgatcgatatc
aatgtgtggtgcgaaatgaggccaggtctgcttgggtggatcatactgaacctgtccaat
attgcccgccaatacaggacgtacggctacattaccaattccatcgtgctctctaccgta
ttccaaaccttctatgttctggatgcgctgtatatggagccggccgtgctaaccacgatg
gatgtgattatggacggattcggttacatgctctcttttggacacctggtatgggtaccg
ttcatctacaatatccaaaccaggtaccttgcggttttcccgttggaattgcgcttgagg
gaaatccttctgatcttggctgttactggcgcggggtacgccattttccgcggtgccaac
aatcagaagaaccgattccgcagggacccaagcgacccacgcatgatgcatatcaagtac
atccagacgtctagtggctcgaagctaatgatttctggctggtggggactggcacgccat
atcaattatttgggcgattggctgatgtcatggtcatattccttgcccaccgggattgct
ggctacaccatcattgaaagcatcaatagcagtggcgacatgcagaagcaggccatacag
actcccgaagtacgcggatggggaatgatttttacctatttcttcttggtttatttcggt
gccctgctcattcaccgggagggacgtgatgaagaaaagtgcaagagcaaatatggcact
gactgggagcgctatacgtctattgttcgcagccgcattattcctggtatttactag

DBGET integrated database retrieval system