KEGG   Aspergillus fumigatus: AFUA_1G05320Help
Entry
AFUA_1G05320      CDS       T01017                                 

Definition
(RefSeq) disulfide isomerase
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AFUA_1G05320
Enzymes [BR:afm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AFUA_1G05320
Chaperones and folding catalysts [BR:afm03110]
 Protein folding catalysts
  Protein disulfide isomerase
   AFUA_1G05320
Membrane trafficking [BR:afm04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    AFUA_1G05320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 OST3_OST6 TraF Thioredoxin_7 AhpC-TSA ERp29_N Calsequestrin DUF3446
Motif
Other DBs
NCBI-GeneID: 3507530
NCBI-ProteinID: XP_750281
UniProt: Q4WJN9
Position
1
AA seq 478 aa AA seqDB search
MMQPSSALLLVASLLAASSVNADGLYTKKSPVLQVTQKTYDQLIANSNYTSIVEFYAPWC
GHCQNLKPAYEKAAKNLEGLAKVAAVNCDDDANKPLCGRMGVQGFPTLKIVTPSKRPGKP
KVEDYQGARSAKAIVDAVVDRIPNHVKRVTDKDLDQWLSEDQESPKAVLFTEKGTTSALL
KAVAIEFLGSIKVGQIRNKESKAVEKFGVKEFPTLVLVPGGDKEPIIYDGELKKQAIVEF
LSQVAAPNPDPAPASTDAKSSKATKSAKSPKSSTILSEEAENLKPTASPDPKVVPDDATE
SKPAQVPIQAPPIPVLPTAEELEAACLKPTSGTCVLALLPEPREGDADVSSPAKEALTSL
SEIAHKHAQRKSKLFPFYSIPAINSGAKTLRAGLGLSEDQTSVEIIALNGRRGWWRRYDA
SEAQDYGAVSVEAWIDAIRLGEGSKSKLPDGVIVEQKEEGDVEAKKDADKEKGDHDEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagccaagctctgcacttctgctcgtggcatcgcttctggcggcttcgtccgtt
aacgcagatggactgtacactaaaaagtctcctgttttgcaggttactcagaagacctat
gaccagctgattgctaactctaattacacatcgatcgtagaattctatgctccttggtgt
ggccattgccagaacctcaaacctgcatacgaaaaggcagccaagaacctggagggactg
gccaaggtagcggctgtgaactgcgatgacgatgccaacaagcctttgtgtggtcggatg
ggcgtacagggtttcccaactctgaagatcgtcactccttccaagagacccggcaagcca
aaagtggaggattaccagggagcaagaagcgcaaaggcgatcgtcgatgctgttgtggac
cgaatcccgaatcatgtgaagagggtcacggacaaggatttggatcagtggctctccgag
gaccaggagtctcccaaggctgttctgtttactgagaaaggtactacgagtgccctcctc
aaggccgtcgccattgagttcctcggctccatcaaggtcggccagattcgcaacaaggaa
tccaaggccgtggagaaatttggtgtcaaggaatttcctaccctcgtcctagtccctggc
ggcgataaggagcccatcatctacgatggcgaactcaagaaacaagccatcgtcgagttc
ctcagccaagtcgcagctcctaaccccgacccggcccccgcctcaaccgacgccaaatcc
tccaaggccaccaagtccgctaagtcgcccaaatcctccactatcctcagtgaagaagcc
gaaaacttgaaacctaccgcatcccccgacccaaaggtcgtccctgatgacgccacagag
tcaaagcccgcccaggtcccgatccaggcaccacccatccccgtactccctacggcagag
gaactcgaagccgcctgcctaaagcctacatctggtacctgcgttctagcacttctccct
gaaccccgcgaaggggatgcagacgtgtccagtcccgcgaaggaggcgctaaccagtcta
tcggagatcgcgcacaagcacgcccagcgcaagagcaagcttttcccgttctacagtatt
cccgctatcaacagcggggccaagactctacgggctgggctgggattgtccgaggaccag
acctcagtcgagatcattgctctgaatggacgcagaggctggtggaggcgctacgacgcg
tcggaggctcaggattatggcgccgtgtctgtggaggcgtggatcgacgccataagactg
ggtgaggggtcgaagagcaagttgccagatggtgttattgtcgagcagaaggaggagggt
gatgtagaggccaaaaaagacgctgataaagagaagggtgaccatgatgagttgtaa

DBGET integrated database retrieval system