KEGG   Aspergillus fumigatus: AFUA_1G06500
Entry
AFUA_1G06500      CDS       T01017                                 

Definition
(RefSeq) hypothetical protein
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 3507658
NCBI-ProteinID: XP_750399
UniProt: Q4WJC1
Position
1
AA seq 273 aa
MDRPGMNRLWDPSKAAWLYPLRGIYYFASHRFLWPLFRARLISIVLLSTFILFVLFLFTY
LPQVAFLAIFQGAGAWVNGAFLVLGEGAAIVALLFEAFFVDETLVDIFDAVLVNEGRGEL
VTACRVLYPQGDDVLKRLGKPTHSAVYSPFSLRQIIEFIVFLPLNFIPVAGTPMFLLLTG
YRAGPLHHWRYFQMLDLSKKQRKERIRRRQLQYTTFGTVALLLQLIPGLSMFFLMSTAAG
SALWVKDIENKRDALREQRDSITNEYPDDDNII
NT seq 822 nt   +upstreamnt  +downstreamnt
atggacaggcccggaatgaacaggctgtgggatcccagcaaagctgcctggctatatcct
ttgcgtggaatctattactttgcgtcgcatcgatttctctggccgctgtttcgggcgcgc
ttgatatctattgtcctgctttctacatttatcctctttgtcctctttcttttcacatat
ctgccacaagttgcctttctggccatcttccaaggcgctggtgcttgggtcaatggtgca
tttctcgttcttggagaaggtgcggccatcgtagcgctactgtttgaggcgttctttgtc
gacgagaccttggtggacatctttgatgctgtccttgtcaacgagggccgtggcgagctc
gtcaccgcttgtagggtcctatacccccaaggcgacgacgttctcaagcggctgggtaaa
ccaacccacagcgcggtgtattcgccattttctctgcggcagattatcgagtttatagtc
ttcctacccttgaactttatccctgtcgcaggcactccgatgttcttgttgttgaccggc
tatcgcgcggggccactccatcactggcggtattttcagatgctggatctgtcgaagaaa
caaaggaaggaaaggatccgtcgacggcagcttcaatacactacattcggaacggttgct
ttgcttctacagcttattcctggcttatcaatgttcttcctcatgtcaactgcggccggg
tctgccctctgggtaaaggacattgagaacaaacgtgatgctttacgagaacaacgtgac
agcataactaatgagtatccggatgatgacaatataatctaa

DBGET integrated database retrieval system