KEGG   Aspergillus fumigatus: AFUA_1G07260
Entry
AFUA_1G07260      CDS       T01017                                 

Definition
(RefSeq) NUDIX family hydrolase
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 3507733
NCBI-ProteinID: XP_750474
UniProt: Q4WJ46
Position
1
AA seq 456 aa
MEPMNPEPNQEPPSLSKSLHTALTDLHRRPYPHVPNPPSCKKRASVALVLRVRPAYDHWP
DSTSLPAEQGQTISTEQRLETFFSQPWVQHGSPEVLFIKRASRVGDRWTGHVAFPGGKRD
LEDTDDRAVAIRETSEEVGLDLTTDDYIYIGNLPERVVTTSWGSVPLMVLCPFVFLSTRS
DSPILKLQPAEYVDMSQRFANRGGLIARLLCRSLMGWMEFAAIQLQPSESLNCTTTPNLD
TITNQSSLSIFQRWKTCFSTAASVGSTRPLHLWGLSLGILADFLDMLPPHTAVRLWKYPT
FTSLDLRFIISLLTYRLRKRNILHVRSGARGDMSNTAVDSQTVALPVLQEVNTQHDYNDV
GIGGLGVGRYYGASDNASDRSTYAVGIMLRGYYEKLRVAIYVFLAWRIALGSVAAVYAWK
FLRDRRIQQVDYHRFQAHLELNQMASRPWNVLFCTM
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggagcccatgaaccccgagccaaatcaagaaccaccatcgctgtccaaatccctccac
accgcattgactgatcttcatcgtcgtccatatccacatgttcctaaccctccatcgtgc
aagaaacgtgcttcagtagctctggtcctccgggtgcgaccagcatatgatcactggcct
gattcgacttctctgcccgctgagcaaggtcaaaccatttccactgaacaacgcttggag
acattcttctctcaaccctgggttcagcatggatcaccagaggtcctgtttatcaaacgg
gcatcacgtgtgggagaccgctggacaggacatgttgcgttccctggagggaagcgtgat
ctagaagatacggatgaccgagcggttgcaattagagagacctcggaggaggtaggattg
gatttgacgacggatgactatatttacattggaaatttgccagagcgggtagtaacaacc
agttggggctcagtaccgttgatggtcctctgtcctttcgtctttttgtcaactcggagc
gattcgccaattctcaaattgcaaccagcagagtatgtcgacatgtctcaacggttcgca
aatcgaggcgggcttattgctcgccttctatgtcggtccctgatggggtggatggagttc
gctgcgattcagttgcaaccaagtgaaagtctaaattgcactacgactccgaacctggat
accattacaaaccagtcaagcctttcaatcttccaaagatggaaaacgtgtttctcaacc
gccgcctccgttggctcaactcgacccctgcatctgtgggggctgtccttgggaattttg
gccgacttccttgatatgctcccgccgcatacggctgtgcggttgtggaagtatcctact
tttacaagccttgacttgcgcttcataattagccttctgacgtatcgtctccgaaaacgc
aatatcctccatgtgagatcgggggctcgaggcgacatgagtaacacggccgtggacagc
caaactgtggcgttgccagtacttcaagaagttaatacacagcacgactataacgatgtt
ggaattggaggcttgggagtgggcagatactatggagcttcagataacgcttccgacagg
agcacatatgctgtcggcatcatgctcagaggctattatgagaagctgcgtgttgcgata
tatgtcttcctcgcatggaggattgccttgggatctgtggcagcggtctacgcatggaaa
ttccttcgagatcgtcgaattcagcaagtagactatcaccgcttccaagcacatctggaa
ttgaaccagatggcgtcacgaccatggaacgtactgttctgtaccatgtaa

DBGET integrated database retrieval system