KEGG   Aspergillus fumigatus: AFUA_1G11110
Entry
AFUA_1G11110      CDS       T01017                                 

Definition
(RefSeq) calcium channel subunit Cch1
  KO
K21864  voltage-dependent calcium channel
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:afm02000]
    AFUA_1G11110
Transporters [BR:afm02000]
 Other transporters
  Pores ion channels [TC:1]
   AFUA_1G11110
SSDB
Motif
Pfam: Ion_trans EF-hand_1 GPHH EF-hand_6 EF-hand_7
Other DBs
NCBI-GeneID: 3510358
NCBI-ProteinID: XP_752476
UniProt: Q4WSZ4
Position
1
AA seq 2125 aa
MASNSHNRGHNEDNAPTDQSIPLQDLSGPLERNPSRTSRVGNRFLSRRSLRRGGSLSNYE
KVSEESPVEPPPVARRARPQQAGHGNEDEFHIEDPGTFAQAMSAVGLSFDPTHSTTTSAR
RRESSSDLINVPLDDFGPQEAEHYLSPTDTYEDTAPLTDHRFLQPISGASQNFSGGQDDR
GSTHGNRFPSDSRPESRLGDDLPHLESGLGRRRRGSSSAGDSRARSLSPSATGSALQRAG
SMMKSMSQRVVNLSNEPEVVEQAIMREEQHKNARLEEPPSLPSLSGYAHDAPSVGMSDDQ
LPRTGTSASKAWRMYNNPLRGKALGILGPNNLIRVWLCDILVHPFMEPFILVVIIIQTIL
LALESAKSVWDHPRSVRWGSNPMDYAYFVIFVIYTLELVAKILVSGFIINPAEYSTLDRS
MGLRKAIAEKGKNLLAPQRQFASKQQASSSPEPQQASIIRTFTGGFDQLQPEVIDDPLQP
RRVRLAHRAFLRHSFNRLDFVAVVAFWVSFLLSFTGVETHHQLYVFRMLSCLRILRLLAL
TNGTSVILRSLKKAAPLLVHVAFLIGFFWLLFAIVGIQSFKSSLRRTCRWLGRDNETDFD
LNDPYGTLQFCGGYLNVTTGAKEPWLKSDLTPSNGDAKGYICPQGSICVENTNPYGGTVN
FDNILHSLELVFVIMSSNTFSDILYYTTDSDYLAAALFFAFGIVILSLWLVNLLVAVITH
SFQVIREESKRSAFAVQKLDSLDTENTSTRKTSSFKRFYDRTEWLWIGIIILDLVVQAMR
SSTMEEDRANLINVVEVFVTIILLFEIILRFASDWRRFHRSRRNWVDLGLALITCVIQIP
AIKHSGRPYDVLTLFQILRVYRVVLAFSVTRNLIMVVFRNATGLLNLIMFVFLITFLASI
FATQLFRGQIPAENNGGDEIDINFADIYNSFLGMYQILSSENWTTMLYDATAFTYPFNTA
WISAIFIILWFIVANFIVLNMFIAVIQESFDVSEDEKRLQQVRAFLEQKQVTGNSQGNLS
LSKILMLGRDSNRYRDPLDHGPAALEMLLKDAVVREFLDEQEAPTESRRRDSAPLETAAA
ATAETVRPGVFSRWWTAITTSVLRREPNPFYSKLKFSRAYEELDPKEMAKEVVSAAEQRK
RAQREYLMRHPNYNKSLFIFAPDNPVRRLCQRIVGPGRGHQRVEGVDPYKPVWYTFSAFV
YAAIVAMVLIACITTPIYQRNYQVQWHGEAMPWYVYTDTGFAILFTIEALIKVIADGFFW
TPNAYFRGSWGFIDGIVLITLWINVGSSLFKDWGVSRAIGAFKALRALRLLNVSDSAKDT
FHSVIIVGGWKVIAAALVSVSFLIPFAIYGVTLYNGQMVKCNDGSIVGSLDQCINEYLSS
PYNWDVLAPRVASNPFYDFDNFGDALFILFQIVSQEGWIDVQNSAMSITGKDMQPQSFAA
PANGLFFIMFNLLGAVFVLTLFVSVFMRNYTEQTGVAFLTAEQRSWLELRKLLRQISPSK
RSLDRKSSKWKLWCYRIAVKKHGRWARCVTVILVLHLLLLVLEFYPEPYLWELTRQALFF
AFTFFYIANVLIRLLGLGWHRFSRSSWDLYSLVAVPGTFVTTILNYLLRNQVIMELNKLF
LVSITLLLIPRNNQLDQLFKTAAASLTAIGNLLATWFVLFLVYAIALNQAFGLTKFGGNE
NNNINFRDIPRALILLFRMSCGEGWNELMEDFATMVPPFCTYDSDFFNDDCGSAAWARPL
FISWNIISMYIFVSLFVSLIFESFSYVYQRSSGLYAISREEIRRFKQAWATFDPDGTGYI
TKEQFPRLLGELSGDFAMRIYDDEFTIGRILEKCRVDKRDSLIAHRRVVEGLDLDKLCRI
LRQIPVETVRKRRQRLNRFYEEVLVSADPVRGISFHSILMILAHYNVISDSKSLRLEEFL
RRRARLQRVEEAVRRNTVIGFFDTLYWSREFRRKVNAKKSSRMSEVPQFTVPEIFVDDGY
QEGSGTAEVGGGGSLGAPDAIVSGDEDTQPMLSPISPTRGPSSPTSSRQLPRLDTNLTGR
MSNVSSPTEWSSISPSLTPGGRERSHTLSSYDAGPDVPISPTGSNHSRENSAMNVQDVMQ
SLDDSAWGESIRRSFTQRRSNGSQP
NT seq 6378 nt   +upstreamnt  +downstreamnt
atggcttcgaatagccacaaccgcggccacaacgaagacaatgctcccacggatcaatca
attcctttacaagacctttccgggccgctggagcgcaatccgtctaggacaagtcgggtg
ggaaacagatttctgtcaaggcgttctttgagacgaggaggctctttgagtaactatgag
aaggtgtcggaggagtcccctgttgaacccccgccagtcgcacggcgtgcacgtccgcaa
caggctggccatggtaatgaagatgagttccatatcgaggatccggggacatttgctcag
gcaatgtcggcggtgggcctcagtttcgacccgacacatagtaccacaacttcagcgcgg
cgccgcgaatctagctcagacttgataaatgtccctctcgatgactttgggccgcaggaa
gctgaacactacctttccccaaccgatacctacgaggatacggccccgttgaccgaccat
cgttttcttcagcccatcagcggagcttcccaaaacttttcaggcggacaggatgaccga
ggcagcacacacggcaaccgtttcccttctgattcgcgtccagagtcgcgtctgggtgac
gatctgccacaccttgagagcggtttgggtcggagacgtcgcgggagcagcagcgctgga
gatagtcgggctcgttccttgtctccttcagccactgggtctgctttgcagcgggcgggt
tcgatgatgaagtcgatgtcgcagcgtgttgttaacctgagtaacgagcccgaggtggtt
gaacaagcaattatgagggaggaacagcacaagaatgcacgactcgaagagcctccgtca
cttccctccttgagcggatatgcacacgatgcgccgtctgtcggaatgtctgatgatcaa
ctaccgcggactggaacatccgcgagtaaagcgtggaggatgtacaacaatcccctgaga
ggcaaagcactcggaatcctgggtccgaacaaccttatacgggtgtggctatgcgacatc
ctagttcatcctttcatggagccatttattctggttgtgattattattcagacgatattg
ctggctctcgaatcggcaaagtcggtctgggatcatccgcgatctgtgcgttggggctct
aatcctatggactacgcttattttgtcatctttgttatttacaccttggagctagtagcc
aagatcctggtatcgggttttatcatcaatccggccgaatacagtaccctagatcgatcg
atggggttaagaaaggcaatcgcggagaaaggaaaaaatctacttgcaccgcaacggcaa
tttgcctccaaacaacaagcctctagctccccagagccacagcaggcctcaattatacgc
acgttcactggtggttttgatcagttgcagccagaagtcatcgatgaccctttacagcca
cgccgcgtgcgactcgcacaccgtgcttttctccggcattcgttcaatcgtctcgatttc
gtcgccgtcgtagcattctgggtatccttcttactctccttcaccggtgtagaaactcac
caccagttatacgtgtttcgcatgcttagctgccttcgcattttgcgtcttcttgcgctc
acaaacggcacatccgtcattctccgaagtctcaagaaagcagctcccttgcttgttcat
gttgcattccttataggcttcttctggctactgtttgctattgtcgggatccagagcttc
aagtcgagcttgcgacgcacttgccgctggcttggtcgtgataatgagactgactttgat
ctcaacgatccgtacggcacactacaattctgcggtggatatctcaatgtaactactggc
gccaaagagccttggttgaaatctgatctcactccgagcaatggggatgcgaaagggtat
atctgtccccaaggctccatttgtgttgaaaacaccaatccatatgggggaacagtcaat
ttcgataacatcctgcattcactagagcttgtctttgtgatcatgagctcaaacaccttt
tcagatattctgtactacactaccgatagtgattatctcgcagctgctcttttcttcgcc
ttcggtatcgtcattttaagtctgtggttggtcaatctgctggttgcagtgatcacgcac
tcattccaagtcatcagagaggagagcaagcgaagcgccttcgctgtccagaaactcgac
tcgctcgatacggagaacacatctacccgcaaaactagtagtttcaaacgtttctatgac
aggacggaatggctctggatcggcatcatcattctcgatctcgttgtgcaggctatgaga
agctcgacgatggaggaggatcgcgcgaatcttatcaatgttgtcgaagtctttgtcacg
atcattcttctttttgaaatcatcctacgctttgcatccgattggcgcagattccaccga
agtcgccggaactgggttgatttagggcttgcgctcattacctgcgtcatccagatacct
gcgatcaagcattcggggcgtccgtatgatgttctcactctctttcagattctccgagta
taccgagtggtactagcgttctcggttaccaggaacctcatcatggttgtctttcgtaac
gcgactggtctgttgaacctgatcatgttcgtgtttctgattacgttccttgcgtcaatt
tttgcgacccagctttttcgcggccagatacccgcagagaacaatggtggtgacgagatc
gatatcaactttgctgatatatataattcgttcctcggcatgtatcagattttgtccagc
gagaattggactactatgttgtacgacgcaaccgcattcacgtacccgttcaacactgcc
tggatttccgccatcttcattatcttatggttcatcgtggcgaacttcatcgttctcaac
atgttcattgctgtcattcaggagagttttgacgtctctgaagacgagaaacggttgcag
caggtcagggcattcctggagcagaaacaggtcaccggtaattctcaggggaacctgtct
ctgtcgaagatcctcatgctgggcagagactccaaccgctacagggatcctctcgatcat
ggaccagccgccctagaaatgctactgaaagatgccgttgtacgggaattccttgatgag
caagaagcgcctacggaaagtcggcgacgggacagtgcgccattagagactgcagcggcc
gcgacggctgagactgtccgccccggcgtgttctcgcggtggtggacggccattaccacc
tctgttttgcgcagggagccgaatcccttctattccaaactgaaattctctagagcttac
gaagagctagatccgaaggaaatggctaaggaggttgtttctgctgctgagcaacggaaa
cgagcacagcgagagtatttgatgagacacccgaattacaacaagtcgcttttcatcttc
gcgcctgacaatcctgttcggagactttgtcaacgcattgttgggccaggacgtgggcat
caacgagtcgaaggagtggatccctataagccggtttggtatacattttcagcttttgtc
tacgcggcgattgttgccatggtcctgattgcgtgcatcaccactccgatctatcagcgc
aattatcaagtccagtggcatggcgaggctatgccgtggtatgtttacactgatacgggc
ttcgcaatcctgttcacaatagaagcactcattaaggtcattgcggacggtttcttctgg
acaccaaatgcatactttcgaggatcatggggattcattgatggaattgtcttaatcact
ctttggatcaatgtgggcagctcactgttcaaggactggggtgtctctagagctattggg
gccttcaaagccttgagggccctgcgtttattgaacgtcagtgacagtgccaaggacacc
ttccactcagttatcatcgtgggtggatggaaagtcatcgctgctgccctggtctcggtc
agttttctgataccatttgccatctatggtgtcaccctttacaacggacaaatggtcaaa
tgcaatgacggaagtatagttggaagtctagatcagtgcatcaatgaatacttaagctca
ccctacaactgggacgtcttagcaccgcgtgtcgcatcaaaccctttttacgactttgac
aattttggggatgctctattcatccttttccagattgtctcccaggagggctggattgat
gtgcagaacagcgctatgagtattacagggaaggacatgcagccacagtcgtttgcggcg
ccagccaacggcctcttcttcattatgttcaatttgctcggtgcagtcttcgtcctgaca
ctgttcgtgtctgtgtttatgcgaaattacacggaacagacgggtgtcgcctttttgact
gctgaacagcgatcgtggcttgagttgaggaaactcttgaggcaaatctctccgtcgaaa
cgctcgctcgaccgcaagagtagtaaatggaagttatggtgctatcggattgcggttaag
aaacatggtcgatgggcaagatgcgtgacagttattcttgtcctccatctcctcttgctt
gtgctggagttttatccggagccttatttgtgggagttgacaaggcaggcattgttcttt
gctttcacatttttctatattgcaaatgtcctcatacgactccttggactgggctggcac
cggttcagtaggagttcctgggacctctactcattagtcgctgtcccgggtaccttcgtt
acgactattctcaactatctgctgaggaatcaggtcattatggaactaaacaagcttttc
cttgtgtctataaccctcctgctgattccgcgaaataatcagttggatcagctcttcaag
acggctgcagccagtttgacggctatcgggaacttactcgctacatggtttgtccttttc
ctcgtctatgcgatagcgctgaaccaagccttcggtctcacaaagttcggtgggaatgag
aataacaatatcaatttccgagacattccgagggcgctcattcttctttttcgaatgagc
tgcggggagggatggaacgaactgatggaggattttgcgacgatggtgccgcccttttgc
acatatgatagcgacttcttcaatgacgattgcggcagcgctgcctgggctcggccactt
ttcatttcatggaacatcatcagcatgtatatctttgtgtctctgtttgtctcgttgatc
ttcgagagcttttcctatgtgtatcaacggagcagtgggctctacgcaatcagtcgtgaa
gaaattcgccgcttcaagcaggcctgggcgaccttcgatcctgacgggacgggctatatc
accaaagaacaatttccccgtctgcttggcgaactctctggcgactttgccatgcgcatc
tatgacgacgagttcacgattgggcggattctggagaagtgtcgggtagataaaagggac
tcactcattgcccatagaagagtggttgaagggctggacctcgacaagctgtgccggatt
ctgcggcaaattccagttgagactgttcggaagcgacgacaacggctgaatcggttttac
gaagaggtgctggtatccgcggacccagtgcgcggtatctccttccactcgattctgatg
atcttggctcattacaatgtcatcagcgacagcaagagcttgagattagaggaattcctt
cgtcgtcgggcgcgtctgcagcgagtagaggaggccgtgcgccgaaacacggtaatcggc
ttctttgatacactgtattggtcgcgggaattccgccgcaaggtcaatgcaaagaaatca
tcacgaatgagcgaagtaccgcagttcaccgtcccagagatctttgtggatgatggttat
caagaggggtccgggacagccgaagtgggcggtggaggtagcctaggggccccagatgcc
attgtgagtggtgacgaggacacccagccgatgctgtcgccgatctcgccgacgcgaggc
ccatccagcccgacatcatcacggcaactgccccggctggacaccaacttgactggacgc
atgtccaatgtcagctcaccgaccgagtggtcgagcatcagtccgtcgctgacaccaggc
ggacgtgaacggtcgcataccctctcgtcctacgacgccgggccggacgtgcccatcagt
cccacaggatccaaccattcgcgagagaacagcgcgatgaatgtacaggatgtgatgcag
tcgttggatgattccgcctggggcgagagtatccggcgcagcttcacccaacgtcgatcg
aacggtagtcaaccgtaa

DBGET integrated database retrieval system