KEGG   Aspergillus fumigatus: AFUA_1G11460Help
Entry
AFUA_1G11460      CDS       T01017                                 

Definition
(RefSeq) 1,3-beta-glucanosyltransferase Bgt1
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
afm  Aspergillus fumigatus
Pathway
afm00500  Starch and sucrose metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFUA_1G11460
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     AFUA_1G11460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_17
Motif
Other DBs
NCBI-GeneID: 3510185
NCBI-ProteinID: XP_752511
UniProt: Q4WSV9
Position
1
AA seq 305 aa AA seqDB search
MRVSTLLPLALAAGTAAASKNGTLGFALGNKNEGGKCKVQSDYETDFDTLKEVTSLVRIY
SASDCDTAKHIIPAAKAKNFKVVLGVWPDYDKSFTDDFNALKEAVPGNEEVIDAITVGSE
VLYRKSLTPQALLARIQQVQKEFPKITVGMVDSWNKFADGTADPIIQGGVTYFLANGFAY
WQGQELSNATNTYFDDMAQALGHIEQVAGSNADKIRFGNGETGWPTTGGTNYGPAVASTA
NAADYYKSAVCGMLAWGVDVFYFEAFDESWKPKTKGDNGEMQDETHWGAFTADRKAKFDL
TCPKH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcagcaccttgctccctctcgctcttgcggccggtaccgctgctgcctccaag
aatggaactttgggtttcgccctgggcaataagaacgaaggcggcaaatgcaaagtccag
tcggactatgagaccgatttcgatacgttaaaagaagtcacctctctcgtgcgcatctac
tccgcgagtgactgcgacaccgcaaagcatatcatccctgcggctaaggcgaagaacttc
aaagtcgtcctgggtgtttggcccgattacgacaaatctttcaccgacgacttcaacgcc
ttgaaagaagctgtccccggaaacgaggaggttattgacgccatcaccgtcggctccgaa
gtgctctaccgaaagagtctcacccctcaggctctgcttgccagaatccagcaggtccag
aaggagttccccaagattaccgtcggaatggtggacagctggaacaagttcgctgatggc
acggccgaccccattattcagggtggtgtcacttatttcctggccaacggcttcgcctac
tggcagggccaggagctgagcaatgctactaacacctactttgatgacatggctcaggct
ctgggccacattgagcaagttgccggctctaatgcagacaagattcgctttggcaacggt
gagaccggatggcccacaactggtggaaccaactacggaccggccgtcgccagcactgcg
aatgctgctgattactacaagtctgccgtttgcggcatgctcgcatggggtgtcgatgtc
ttctactttgaggccttcgacgagtcctggaagcccaagaccaagggcgacaacggtgag
atgcaagacgaaacgcactggggtgctttcactgcggaccgtaaggccaagttcgatttg
acctgccctaagcactag

DBGET integrated database retrieval system