KEGG   Aspergillus fumigatus: AFUA_1G12840
Entry
AFUA_1G12840      CDS       T01017                                 

Definition
(RefSeq) nitrite reductase NiiA
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
afm  Aspergillus fumigatus
Pathway
afm00910  Nitrogen metabolism
afm01100  Metabolic pathways
Module
afm_M00531  Assimilatory nitrate reduction, nitrate => ammonia
afm_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AFUA_1G12840
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     AFUA_1G12840
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Rieske_2 Fer2_BFD Rieske NIR_SIR_ferr Rubredoxin_C Amino_oxidase FAD_binding_2 Rep_N
Other DBs
NCBI-GeneID: 3510300
NCBI-ProteinID: XP_752654
UniProt: E9R4B8
Position
1
AA seq 1102 aa
MPLIDNSRSNDAVQSSICNGISHTTIIESVRDPDYRHNDPNRRQKIVIVGLGMVAISFIE
KIVKQDAERRKYDIVVIGEEPHIAYNRVGLSSFFEHRKIEDLYLNPKEWYGSFKDRSFDY
HLNTKVTDIFPERKTVRTSTGDVIPYDILVLATGSDAVLPTHTPGYNAKGIFVYRTIQDL
ERLIEFASKHKGETAVTVGGGLLGLEAAKAMTDLEDFGRVKLIDRNKWVLARQLDGDAGT
LVTRKIRELGLDVLHEKRVAKIKTDDDNNVTGITFEDGEEIDCCCICFAIGVRPRDELGP
PAGIQCAGRGGFVINESLQTSIPDIYAIGECASWENQTFGIIAPGIEMADVLSFNLTNPD
KEPKSFKRPDLSTKLKLLGVDVASFGDFFADRDGPKFLPGQRPSIVDGSVGNADGDKEPS
VKALTYKDPFAGIYKKYLFTMDGKYLLGGMMIGDTKDYVKLNQMVKSQKPLEVPPSQFIL
GAQKEGEENADDLDDDAQICSCHNVTKGDIVENVKSGTCKTIGEIKSCTKAGSGCGGCMP
LVQSIFNKAMRDMGQEVSNHLCMHIPYSRADLYTVIAVKRLRTFVDVMQAVGRKPDSLGC
EICKPAIASILSSLFNQHIMDKELHDLQETNDRFLANIQRNGTFSVVPRVPGGEITADKL
ITIGQVAKKYNLYCKITGGQRIDLFGAKKQDLLDIWTELVDAGMESGHAYAKSLRTIKSC
VGTTWCRFGIGDSVGMAIRLEERYKSIRSPHKLKGAVSGCVRECAEAQNKDFGLIATEKG
YNIFVGGNGGAKPRHSELLAKDVPPEKVIPIIDRYLIFYIRTADKLQRTARWIENLPGGI
NYLREVIIDDKLGIGAEMEQQMEELVNSYFCEWTETVRNPKRRKYFQQFANSDETVDTVE
VIKEREQQRPTYWPKDSAGEDFKGHQWSSLSWQPVIEANYFSDEHPQISSANIKRGDTQL
AIFKVKGKYYATQQMCPHKRAFVLSDGLIGDDDAGKYWVSCPYHKRNFELNGEQAGRCTN
DESMNIATFPVEERDDGWVYMKLPPVEELDSVLGTEKWKVRKGEAPDPFQKVDKRYKGMR
GKKACDISTKAPTTQAANIIDW
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgccgttgattgataactcaagaagcaacgatgctgtccagagcagtatctgcaacggt
atatcccatacgacaatcatcgagtctgtcagagacccagattatcgtcacaatgacccg
aaccgacggcagaagattgtaatcgtcgggttgggcatggttgcgatctcattcattgag
aaaatcgtcaaacaagatgcagagagacgcaagtacgacattgttgtgattggggaggag
cctcacattgcctataatcgcgtcggtctctcctcgttttttgaacatcgcaagatcgag
gatttgtacctcaatcccaaggaatggtacgggtcattcaaggaccggtcattcgattat
cacctcaacaccaaggtcactgacattttccctgaacgcaagaccgtcaggacgtcaact
ggcgacgttatcccctatgatattctagtcctcgctacaggctcagatgcagtactcccc
acacacactcctggctataatgccaagggtatcttcgtttacagaacaattcaagacctg
gaacgtctcatcgagttcgcttcgaaacacaagggcgagaccgcggtcactgtaggagga
ggcttgctcggcttggaagcagccaaagcaatgacagatctcgaggatttcggaagagtc
aaactcattgaccgcaacaagtgggttctggcacgacagctcgacggcgatgccggcaca
ctcgtaactcggaagatcagagagctaggcctggacgtattacacgagaagcgggtcgca
aagatcaaaacggatgacgacaacaacgtcacaggcatcacctttgaagatggggaagag
attgactgctgctgcatctgttttgctattggagtgcgacccagagatgagctggggcct
cctgccggcattcaatgcgctggacggggagggtttgttattaatgaaagtttgcaaact
tccattcccgatatctatgccattggcgaatgtgctagttgggagaatcagacgttcgga
ataatagcacctgggattgagatggccgacgtgctttccttcaacctgacaaatcccgat
aaggagccaaagagcttcaagcgacccgatctgagcacaaagctcaagctccttggtgtt
gacgttgccagctttggtgacttctttgccgacagagatgggcctaaattccttccgggg
caacggccatcgattgtcgatggctctgtggggaacgctgatggtgacaaagagccaagt
gtcaaggcattgacatacaaggaccccttcgccggaatctacaagaagtacttgttcact
atggatgggaagtacttgcttggaggtatgatgattggcgacaccaaggactacgtgaag
ttgaaccagatggtcaagagccaaaagcctctcgaagtacctcccagtcagtttattctt
ggagcgcagaaggaaggcgaagagaatgccgatgacttagacgacgacgctcagatctgc
tcgtgccacaatgtcacaaagggggacatcgttgagaacgtcaagagtggtacatgcaag
actattggcgagattaaatcgtgcacgaaagccgggagtggttgtgggggctgtatgccc
ttggtgcagtcgatcttcaacaaggccatgcgggacatgggccaagaagtatccaaccat
ctctgcatgcacatcccatattcacgggccgatctttatactgtaattgctgtcaagagg
ctgagaacatttgtcgatgtcatgcaggccgtgggaaggaagccggactctcttggctgc
gagatttgcaaacccgccattgcatccattctttcgagtctgtttaaccagcacatcatg
gacaaggagcttcatgaccttcaagagacaaatgaccgattccttgccaacatccagaga
aacggcacattctctgtggttccgcgagtccctggtggtgagatcactgcagataaactg
atcaccattggtcaagtggcgaaaaaatacaacctttactgcaagattacaggaggtcag
cgtattgacttgtttggtgccaagaagcaagatcttctcgacatctggacggagcttgtg
gacgccggaatggagagtggtcatgcttatgccaagtcgctccgaacaatcaagagctgc
gtcggaactacatggtgccgctttggtatcggcgacagtgttggaatggcgatccgactg
gaggagcgctacaagagtattcggtcaccccataagctcaagggtgcggtatctggttgt
gtcagagagtgcgccgaagctcagaacaaggatttcggattgattgcaaccgagaaggga
tataacattttcgttggtggcaatggaggtgccaaaccccggcattcggaattgcttgcg
aaagatgtgcctcctgagaaagtcattcctatcattgatcgatatctcatattctatatt
agaacggcagacaaacttcagcggactgcccggtggatcgagaacctccccggcggtatc
aactatctgcgagaggtgatcatcgacgacaagttggggattggcgctgagatggaacag
cagatggaagaactggtgaacagctacttttgtgagtggaccgagacagtccgcaatcct
aagcgacgcaagtactttcagcagttcgccaacagcgacgagactgtcgacacagttgag
gtcatcaaagaacgcgaacagcagcgacccacatactggcccaaggactcggcaggcgag
gacttcaagggtcaccagtggtcgtctctatcatggcagcctgtcatcgaagccaactac
ttttcagatgagcacccgcaaatctcctcggccaacatcaagcgcggggatactcagttg
gccatcttcaaggtcaagggcaagtactacgccacacaacagatgtgcccgcacaaacgc
gccttcgtgctatctgatggcttgattggcgatgacgatgcgggtaaatattgggtctcc
tgcccttaccacaaacgcaacttcgagctcaacggtgagcaggcagggcgttgcacgaat
gacgagagcatgaacattgcgaccttcccggttgaggaacgcgacgacggctgggtgtat
atgaagctgcctcccgttgaggaactagattccgttttgggaacggagaaatggaaggtg
aggaaaggggaagcaccagatccgttccagaaggtcgacaagaggtacaagggcatgagg
ggcaagaaggcgtgtgatatcagtacgaaagccccgaccacacaggcggcaaacatcatc
gattggtag

DBGET integrated database retrieval system