KEGG   Aspergillus fumigatus: AFUA_1G14990Help
Entry
AFUA_1G14990      CDS       T01017                                 

Definition
(RefSeq) ATP-dependent RNA helicase (Drs1)
  KO
K13181  ATP-dependent RNA helicase DDX27 [EC:3.6.4.13]
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:afm03041]
    AFUA_1G14990
   03009 Ribosome biogenesis [BR:afm03009]
    AFUA_1G14990
Enzymes [BR:afm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     AFUA_1G14990
Spliceosome [BR:afm03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    AFUA_1G14990
Ribosome biogenesis [BR:afm03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    AFUA_1G14990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C UTP25
Motif
Other DBs
NCBI-GeneID: 3509891
NCBI-ProteinID: XP_752868
UniProt: Q4WRV2
Position
1
AA seq 830 aa AA seqDB search
MAPNAATKKRAAARDDDFVLTLSDDENDIFENGVEEDGDNAQEDTLSSSKKRKREAAEAP
KGKNKKQKQLKKSKKGESAAGAVSDDQSSEEDEAEAMDAGEDDGALDSEFEFDVGGNANT
GVIEGFDGWEARNGASLADAPKNGDKKAVDIDDIISRRKAKKEAELKKKQQKEKKRREEE
GEEESEGEDADSDGGMSVDFQDDELLAADGFGMGADGADESDDDVENGSNDSDDSEGKGS
EDEESGDEYNDDDAASDNDSVATPVHHPDDEAASDEESEAESEVDAEEAEKRKAFFAPEE
KSTAVSTFNRSFQDFNLSRPILRGLASVNFTTPTPIQQKTIPVALLGKDIVGSAVTGSGK
TAAFVVPILERLLFRPRKVPTSRVAILMPTRELAVQCYNVATKLATHTDITFCQLVGGFS
LREQENILKKRPDVIIATPGRFIDHMRNSPSFTVDTLEILVLDEADRMLEDGFADELNEI
LTTIPKSRQTMLFSATMTDSVDKLIRVGLNRPVRLMVDSKKNTSMNLTQEFVRLRPGRED
KRLGYLLYLCNEIYTGRVIVFFRQKREAHRVRIVFGLLGLKAAELHGSMSQEQRIKSVEN
FREGKVAFLLATDLASRGLDIKGVETVINYEAPQSHEIYLHRVGRTARAGRSGRACTIAA
EPDRKIVKSAVKAGKAQGAKIVSRVVDPAVADEWAAKAKGLEDEIEEVLQEEKLEKQMAQ
AEMQVTKGENLIKHEAEIMSRPKRTWFETERDKRAARKLGATELNGPSKKDKVKLSNKDK
KRLDDARQRHEGNIGWKKGKADREAPKQGKNKGGKTKSDKKNKIKMKGKK
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaacgctgcgacaaaaaagcgggctgccgccagagatgacgatttcgtgctc
acactatcggacgacgagaacgatatcttcgagaacggtgttgaggaagacggcgacaat
gcccaggaagacactctttccagctcgaagaaacgcaagcgagaggcggcggaggccccg
aaaggaaagaacaagaagcagaagcaattgaagaaaagcaagaagggcgagagcgctgct
ggcgcagtatctgacgaccaatccagcgaagaggatgaggctgaggctatggatgctggt
gaggacgatggggctttggactcggagttcgagttcgacgttggcggcaatgctaatacc
ggtgtgattgagggatttgatgggtgggaagctcggaatggagccagtcttgcggatgcg
cccaagaatggggataagaaagctgtggatattgatgatatcatatccaggaggaaagcg
aagaaagaggctgaactgaaaaagaagcagcagaaggagaaaaagaggagggaggaggaa
ggagaggaggagagtgaaggtgaagatgccgactctgatggcggtatgtcagtggacttt
caggacgacgaattgcttgctgcagacggatttggtatgggtgccgatggtgcagatgag
agtgacgacgatgtggagaacggctccaatgacagcgacgattcggagggaaagggcagc
gaggacgaggagagtggtgatgaatataatgatgatgatgctgcttccgataacgactca
gttgccactccagtacaccatcctgatgacgaagcagcgtctgacgaggaatctgaagcc
gagagcgaggttgatgctgaggaagcagagaagcgcaaggctttctttgcacctgaagaa
aagtccacagccgtgtcgacttttaatcgatcgtttcaggacttcaatctgtctcgaccc
atcctccgtggtttggcatctgtcaatttcaccacgccgactcccatccagcaaaagacg
atccccgtggctctccttggaaaagacatcgtgggtagtgctgttactggctcaggaaag
actgctgcgttcgttgttcccattctcgagcgtctgctgttccgccctcgaaaagttccc
accagtcgtgttgctatccttatgcccactcgtgaattggccgttcagtgttacaatgtg
gctacaaaactggctactcatactgatattaccttttgtcaacttgtcggtggtttcagt
cttcgcgagcaggagaacatcttgaaaaagcgccccgacgtgatcattgctactcctggt
cgttttatcgaccacatgcggaattcccccagcttcactgtcgacacactggagattttg
gttctcgatgaagctgatcggatgttggaagatggtttcgctgacgaacttaacgaaatc
ttaacaaccattcccaagtcgcggcaaacaatgctcttttcggctacaatgacagactcc
gtggacaagctcattcgggttggtctcaaccgtccagttcgcttgatggtcgactcgaag
aaaaatacatccatgaatctgacccaggagttcgtccggttacggccaggtagggaggac
aagcgcttgggatatcttctttacctgtgcaacgaaatctacactggacgggttatcgtc
ttcttccggcagaagcgcgaagcccatcgggttcgcattgtctttggattattgggactt
aaagcggcagagctacatggtagtatgagccaagaacagcgtattaaaagtgtcgagaac
ttccgagaaggcaaagtagccttcctacttgctactgatttggcgtcccgtggtctggac
atcaagggtgtcgaaacggtcatcaactacgaagcgcctcagagccatgagatctacctg
catcgtgttggtcgaacagctcgtgctggccgttccggacgcgcatgcaccattgcagct
gagccggaccgcaagatcgtcaagtcggccgtgaaggccggcaaagcacaaggggccaag
attgtcagccgcgtcgttgacccagccgttgcggatgaatgggccgctaaagccaagggc
ttggaagatgagattgaggaggtgttacaggaggagaagttggagaagcagatggcacag
gcggaaatgcaagtgaccaagggggagaatttgatcaagcacgaagccgagattatgtcg
cggccgaagcgcacttggttcgagactgaacgtgacaagcgtgcggcgcgcaaattgggt
gctaccgagctcaacggaccatctaagaaggataaagtaaagctgagcaacaaggataag
aaacggcttgacgacgcgcgccagcgtcatgaaggcaatattggttggaagaagggcaag
gctgaccgagaggctcccaagcagggtaagaataaggggggcaaaaccaaaagtgacaag
aaaaataagatcaagatgaagggaaagaaatga

DBGET integrated database retrieval system