KEGG   Aspergillus fumigatus: AFUA_1G15820
Entry
AFUA_1G15820      CDS       T01017                                 

Definition
(RefSeq) fatty acid hydroxylase
  KO
K19703  4-hydroxysphinganine ceramide fatty acyl 2-hydroxylase [EC:1.14.18.6]
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AFUA_1G15820
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.6  4-hydroxysphinganine ceramide fatty acyl 2-hydroxylase
     AFUA_1G15820
SSDB
Motif
Pfam: Cyt-b5 FA_hydroxylase Anth_synt_I_N COX14
Other DBs
NCBI-GeneID: 3509972
NCBI-ProteinID: XP_752948
UniProt: Q4WRM2
Position
1
AA seq 513 aa
MFLPDGCYSSFLVNDSGFCICNLSLITHPSSVQSTCGKPKRKAVLCKSAVVTGAVFWSHR
LYDGSRSERTRLDIISKLTPLLFVAIYFHIFAVPPESSGFLNLATLLLTVGLVDSIFLES
VSAARSGISISTKYPIMPGKILPTFTPAEVESHNHAKSCFVTLGSKVYDVTSFLNDHPGG
GDLILEYAGKDVKEILRDESSHNHSEAAYEILEDLLVGFLDNKSTGKTADTNGSATEGSE
EDSRPVYASTGMSSEEDLSVETDIVKDYQTFKFLDLNKPLLLQLWNSGFSKEFYLQQIHR
PRHYKGGESAPLFGNFLEPLSKTAWYVVPLLWLPPVTYGSFVGFAGLGNVPTAASYWLFG
LFLWTLIEYLMHRFLFHIDGYLPDNRVGITLHFLLHGIHHYLPMDKYRLVMPPALFVILA
TPFWKLAHTVFFYNWYAAVTVFCGGVFGYICYDMTHYFLHHRNLPAYYKSLKKYHLEHHF
ADYENGFGVTSRFWDRVFGTELKTPPPKGAKAQ
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgtttctcccagatggttgctactcctcgtttctcgtcaacgactctgggttttgcata
tgtaatctatcactcatcactcatcccagctcggtccaaagcacctgcggaaagccgaaa
agaaaggcggtgctctgcaaaagtgcggtcgtaactggcgcagtgttttggtcccatcga
ttgtacgacggatcccggagcgagcggacccgccttgatattatttcgaagctcacgcca
ctccttttcgtcgcgatttattttcacattttcgccgttccacctgaaagctctggattc
ctgaacttagcgactttgttactcacggtcggtctagttgattccatatttctcgagtct
gtgtctgcagcacgcagcggtatttcaatatccacgaaatatccgatcatgcccggaaag
attctgccaacattcacgcctgccgaggtcgaatcccacaaccacgccaaatcttgcttt
gtgactctggggtccaaggtttacgatgtcacatcctttctcaatgatcatccgggaggc
ggcgacttaattctcgaatatgctgggaaagatgtgaaggagatcttgcgggatgagtcc
tctcacaatcactctgaggcggcttatgaaattctagaggacctccttgttgggtttctc
gataacaaatctaccggaaagacagcagatacgaatgggtcagctaccgaagggtcagaa
gaagattcgcggccagtgtatgcttcgacaggcatgtcgagcgaagaggacctgtccgtc
gaaacagacatcgtcaaggattatcaaaccttcaagtttctagacctcaacaaaccattg
cttcttcaactctggaatagtggcttcagcaaagagttctacctacagcagatccaccgg
ccgcgccactataagggaggggagtcggcccccctatttgggaacttcctggagcccttg
agcaagaccgcgtggtatgtggttcctttgctctggcttcctccagtcacctatggaagt
tttgttggatttgctggactgggaaatgtccctacagcagcctcctactggctgtttggt
cttttcctttggaccttgattgaatatctcatgcacagatttctttttcacattgacgga
tatctccctgataatcgagtcggcatcaccctccatttccttcttcacggaatccaccat
tatctgccaatggataaataccggcttgtgatgccaccagctttgttcgtgattctggcc
acgcccttctggaaactggctcacacagttttcttctataactggtacgctgcggtcaca
gttttctgtggtggcgtatttggatatatctgttatgatatgacacattacttcctccac
caccgcaacttgcccgcttactataagtcgctcaagaagtatcaccttgagcaccacttt
gccgactatgaaaacggctttggtgtcacaagtcgcttctgggaccgggtgtttggcacc
gaactcaaaaccccgccacccaagggcgcgaaagctcaatga

DBGET integrated database retrieval system