KEGG   Aspergillus fumigatus: AFUA_1G15950Help
Entry
AFUA_1G15950      CDS       T01017                                 

Definition
(RefSeq) MAP kinase kinase (Pbs2)
  KO
K11227  mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
afm  Aspergillus fumigatus
Pathway
afm04011  MAPK signaling pathway - yeast
afm04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:afm00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AFUA_1G15950
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    AFUA_1G15950
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AFUA_1G15950
Protein kinases [BR:afm01001]
 Serine/threonine kinases: STE group
  STE7 family
   AFUA_1G15950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Seadorna_VP7 Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 3509985
NCBI-ProteinID: XP_752961
UniProt: Q4WRK9
Position
1
AA seq 656 aa AA seqDB search
MSTATVGPGQESVAEVPSAQIDIDDRSDNTTDDDLSPSVTAPPSLTSVPSLRPDRDMTSG
ISASSTHLGQINAARRGAGTPTRPHASMSGAQPGGLNQDILAKMKAFSLSRQGAPPHLPH
AVSTGTIPSSRPSISASPSPVGGPSPPMGGALAGRLPPTARPHGKNWASSPSVPGATAGS
HSPSPKTGSLAAKRMKPGLKLSDATGPATGSGTSSPGDGSSDASGGSAFSKYSEYIDTKA
GTLNFKNKAILHGGGVEFSSGHSFSISLDEVERLDELGKGNYGTVYKVRHSRPHMRKPGM
GLRGIISRPAENSTPDSTSAAKPQDNLSGYIMAMKEIRLELDENKFAQIIMELDILHRCV
SPFIIDFYGAFFQEGAVYMCVEYMDGGSIDKLYKDGVPENILRKVALSTVMGLKTLKDDH
NIIHRDVKPTNILVNSRGQIKICDFGVSGNLVASIAKTNIGCQSYMAPERIAGGGVQQSG
ATGGGTYSVQSDIWSLGLTIIECAIGRYPYPPETFNNIFSQLHAIVHGDPPTLPEEGYSE
EAHAFVHACLDKNPSKRPSYSTLLRHPWLAPLMQPPTESNGTEATSAAPSAGQPGGPDTS
TATEDEEVAEWVKERIERRQRGHLQEAEKPALHAVALDAVPGSPLLDDPSSLPSLS
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggctacagtgggcccagggcaagaatcggtcgcagaagttccctccgctcaa
atcgatattgacgaccgatccgacaacacaacggacgatgacctttccccctctgttact
gctcctccgtctcttacttcggtgccatccctgcggccggatcgggatatgacatcgggg
ataagtgcttcgtctactcatttgggccaaatcaatgcggctcggcgtggtgcagggaca
ccgacacggccgcacgcctccatgagtggcgcacagccgggcggtttgaatcaggacatc
ctggccaagatgaaggccttctccctctccagacagggtgcccccccccatttacctcat
gctgtctctaccggaacaatcccttcgtccaggccaagcatttccgcttcgccaagtccg
gtaggagggccgtcgcctcccatgggaggtgcacttgccgggcgtcttcccccgacagca
cgccctcatggtaaaaattgggcgtcttcaccctcagtaccgggagctactgcaggttct
cattcgccttcgccaaaaaccggcagcctggccgcaaaaagaatgaaaccagggttgaaa
ctgtcagatgccactggccctgcgactggctctggaaccagctcgcctggcgatggatct
tcggacgcatctggagggtcagcattcagcaaatattcagagtacattgacacgaaggca
gggactcttaatttcaagaacaaggcgattctgcacggtggcggcgtcgaattctcgtcc
ggacatagtttcagcatctcgttagatgaggttgagcgactggatgagctaggtaagggc
aactacggaaccgtctacaaagttcgacatagccggccccatatgcgcaaacctggtatg
gggcttcgcggcatcattagtcgcccagctgagaactcgaccccggatagcacttctgcg
gctaagccccaggacaatctttctggttacattatggcgatgaaggagattcgcttggag
ctggatgaaaacaaatttgcccagatcatcatggagctggatatcttgcaccgttgcgtt
tcgccattcattatcgacttctacggcgctttctttcaggagggtgcggtctatatgtgt
gtggagtatatggacggaggctctatcgataaactctacaaggacggcgtacccgaaaac
attcttcgaaaggtcgcattatccaccgttatgggattgaagaccctcaaagatgatcat
aacatcattcatcgggacgtgaagcctactaatattctcgtcaattcccgaggtcaaatc
aagatttgcgatttcggcgtgagcggcaatttggtcgccagtattgcgaagactaatatt
ggctgccagagttatatggcacctgaacgtattgcaggaggcggcgtccagcagtccggc
gcgactggtggtggaacttatagtgtgcagagcgacatctggagtttgggcctgaccatc
atcgaatgcgctatcggtcgctatccatatcctccggaaacctttaacaacattttcagc
cagttgcatgctatcgtgcatggggatccgccaaccttaccggaggaaggatattcggaa
gaggcgcatgcatttgtccatgcttgcttggacaaaaatcccagcaagcgtccttcgtat
agtaccttactcagacatccctggcttgctcccttgatgcaacccccgacagagtcgaat
ggtaccgaggcaacgtccgccgctccatctgctggccaacctggcgggcccgatacgagt
actgcgactgaggatgaggaggtggcggaatgggtcaaggagcgaattgaacgtcgccaa
cgggggcacctacaagaggcagagaaacctgcattgcatgcagtggccttagatgcagtg
cccggtagccctctgcttgatgatccctcctcgctcccatcactttcttag

DBGET integrated database retrieval system