KEGG   Aspergillus fumigatus: AFUA_2G00640
Entry
AFUA_2G00640      CDS       T01017                                 

Definition
(RefSeq) beta-N-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
afm  Aspergillus fumigatus
Pathway
afm00511  Other glycan degradation
afm00513  Various types of N-glycan biosynthesis
afm00520  Amino sugar and nucleotide sugar metabolism
afm00531  Glycosaminoglycan degradation
afm00603  Glycosphingolipid biosynthesis - globo and isoglobo series
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFUA_2G00640
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    AFUA_2G00640
   00531 Glycosaminoglycan degradation
    AFUA_2G00640
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    AFUA_2G00640
   00604 Glycosphingolipid biosynthesis - ganglio series
    AFUA_2G00640
   00511 Other glycan degradation
    AFUA_2G00640
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:afm03110]
    AFUA_2G00640
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AFUA_2G00640
Chaperones and folding catalysts [BR:afm03110]
 Intramolecular chaperones
  Others
   AFUA_2G00640
SSDB
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Other DBs
NCBI-GeneID: 3506992
NCBI-ProteinID: XP_749201
UniProt: Q4WIU2
Position
2
AA seq 747 aa
MGLLISRMQGADVTSTTTECNPCVYLFCTASAICSGQFQNMYLNVILCFSLVTAALQTLP
PVDQTTLGPLPGFDVHSVERVVYIKADFASHRDENGLTLIPPSALEFATTFLHDLQEVTA
SQWTLRQVNHFSAKQGIFLDRLGTDCNLTYENGTPTEEGYEVEIRPRRVDIRGSGARGMW
WGTRTMLQKLILADGKPLPGGRIVDAPSVPTRGYMLDAGRKWYSPGFLKDLCTYASFFKM
SEFHYHTSDNYPLNRGHNETWSEVYAQFSLHPESPDLHGIVQRPNETLSRADYEELEQHC
AQRGVTVVPEIEAPGHCLFLTKWKPELALEKKDLLNLSHPDAVPLVKSVWGEFLPWFHTK
EVHIGADEYDSTLADDYINFVNEMAQFIQKESGKRIRIWGTYEPSDTLSISKDVIVQHWQ
YGQSDPVSLANDGYIMINSEDQWAYMSLKNDHMPIFPAPYPYLFNTSRVLNFANIDGWQW
TPALFNPFNVTEQPNKQAVQGAILVAWNDNGPDATTQLEAFYAMRNGIPIVASRAWTGDR
GPRLDESSLSWSAKLLTARAAGQNLDRRFTGGVNHKTDSLFSWTSGKQSGERIHLGYGSK
GMNYTLELDVAGPFVLSSEDCALSLSASGTLAFTSDGWEYPLRSVAENAGFDPGYPGRIW
TNETSSTHEPVQIPLHSQIIIRTDVIGGSRVWVDGSFVGRFEVFVFGGKNQLFSWSQMAF
VAPLEWIQGGLHGLRIAEYDGSYSSSD
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgggattgttgatctccagaatgcaaggagccgatgtaacctcgacaaccacagaatgc
aacccttgtgtatacttattttgcacagcatcagccatttgctcaggacagtttcaaaat
atgtatctaaatgtcattctatgtttcagtctagtgactgctgcactgcagacacttccc
ccagtggatcaaacaacattaggaccgttgccgggctttgatgttcactcagtggagaga
gtcgtctatatcaaggccgattttgcttctcatcgggacgaaaatggattgacactgatt
cctccatctgctttggaattcgcaacgacattccttcatgatctacaggaggtgaccgcc
agccagtggacactccgccaggtcaatcatttcagtgcaaaacaaggcatcttccttgac
cgacttgggacagactgcaatctgacctatgaaaatggcacgccaacagaggaagggtat
gaagtggaaattcgcccgcgacgggtcgatatccggggatctggggcaagagggatgtgg
tggggaacgcggaccatgctgcagaagttgatcctcgctgacgggaaaccgctcccgggt
ggtcgcattgtggacgcaccctctgttccaactcgaggatacatgctcgacgcgggccgt
aaatggtactcgcctggctttctcaaggacctgtgcacgtacgcctcgttcttcaagatg
tccgagttccactatcacaccagcgacaactaccctctcaatcgggggcataatgagaca
tggagcgaggtgtacgcgcagttttcactccaccctgagagtcctgaccttcatggcatc
gtgcagagaccgaatgagacgctgtctcgagcggactatgaggagctagagcagcattgt
gcgcagcgcggagttacggttgttcctgagattgaagcgcccggccattgcctgtttctg
accaaatggaagccagaactggcgttggagaagaaagatctgctgaacctttctcatcca
gacgcggtgccgcttgtcaagtccgtctggggcgaattcctgccatggtttcacacaaag
gaagtgcatatcggggcggatgagtacgactcgacattggcagatgattatatcaacttt
gtcaatgagatggcacaattcatccagaaggagtctggaaaaaggattcgcatatggggt
acttatgaaccatcagatacgctttctatatccaaagatgtgatcgttcaacactggcaa
tacgggcaatcggatcctgtcagcctggcaaatgatgggtacattatgatcaattcggag
gatcagtgggcgtacatgtcgctgaaaaacgaccatatgcccatatttccggccccgtat
ccatacttgttcaatacctcgcgagtgttgaacttcgccaacatcgacgggtggcagtgg
accccagcgctcttcaacccattcaacgtcactgagcaacccaacaaacaggcagtccag
ggcgcaattctagtcgcatggaatgacaacggaccggacgcgacaacacagctggaggcc
ttctacgcgatgcgcaatgggatcccgattgtcgcctctcgagcatggacaggcgatcga
ggcccgcgactggatgaatctagcttgtcttggtctgcgaaactgcttactgcccgtgcg
gctggccagaaccttgacaggagatttactggtggggtcaatcacaagacggactcgctt
ttcagctggacgtccggcaaacaatcaggagaaaggatccacctcgggtacggcagcaag
ggaatgaattatacactagagctcgacgtcgcggggccattcgtgctgtcctccgaggac
tgcgctctaagtctatccgcatctggtactttggcctttacatccgacggatgggagtac
ccgcttcgctctgtcgccgaaaacgccggattcgacccagggtatccgggacggatttgg
acaaacgagacatcctccacgcatgaacccgtccaaatccctctccacagccagatcatt
attcgcacagatgtcattggagggagcagagtctgggttgatgggagttttgtcgggaga
ttcgaagtctttgtctttgggggaaagaaccaactgttttcgtggagccagatggcattt
gtggcgccactagaatggatccaagggggattacatggactgaggattgctgaatatgat
ggcagttatagttcgagtgattaa

DBGET integrated database retrieval system