KEGG   Aspergillus fumigatus: AFUA_2G01240Help
Entry
AFUA_2G01240      CDS       T01017                                 

Definition
(RefSeq) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
afm  Aspergillus fumigatus
Pathway
afm00052  Galactose metabolism
afm00500  Starch and sucrose metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AFUA_2G01240
   00500 Starch and sucrose metabolism
    AFUA_2G01240
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AFUA_2G01240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 3506983
NCBI-ProteinID: XP_749260
UniProt: Q4WIN3
Position
2
AA seq 514 aa AA seqDB search
MRASFILFSAAVAAAQTANYSGPLRPQVHFSPPSQFMNDPNGLFYDHKREVYHLYYQYNP
SEIVAGNQHWGHATSKDLYHWTNHPIAIAPSQPGEWIYSGSAVMDSNNTSGFFPDQDDGV
VAIYTLATETLQTQQIAYSRDGGYTFTKYENNPVLDIDSSQFRDPQVTWHPETQKWVMTI
AYADDRVIGFYTSPNLKEWTHASNFTQSGLPGTQFECPNLVKFSVDDCDDSEDPTKWVLF
ISVNPGAPLGGSGTYYVVGSFNGTHFTSESPRETLYDFAKDNYASQWYSGIPEDEPPVSI
GWASNWNYTQQVPTGPLEGWRSSMSLPKVHTLTKVDGSWVVTKEPFDGLDSVRGKQLKGK
RSRNGDVTFDFKNVKSNAVAFDVKINGIPSSGATGQVYFNFTSSTSGEYVDGGLRLDNGF
FWINRAGTHLFTQANSTGYWPVFNTTVKSYDHHKFTFSGVIDRSLLEVTLAEGVQTGTMS
FYPTHPLDTLTVSGSDLSKKTSFRAKAWGLESGW
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcttctttcattctcttctctgctgcagtggcagcggcccaaacagccaactat
tccgggcctctgcggcctcaggttcacttctcccctccttctcagttcatgaatgacccc
aatgggcttttctatgatcacaagagggaggtttatcacctgtattaccaatacaatcct
tccgagattgttgcaggtaatcagcactggggccacgcaaccagcaaggatttgtaccac
tggaccaaccaccccattgccatcgcccctagccagccgggcgagtggatctattccggc
tcggctgtgatggacagcaacaacacctcgggattcttccccgaccaggacgacggtgta
gtcgctatctacactctggctactgagacgctacagacgcagcaaatcgcctactcccgt
gacggcgggtatactttcaccaagtatgaaaacaacccggttctcgacattgactccagc
cagttccgtgacccccaggttacatggcatcccgagacccagaaatgggtcatgaccatt
gcttatgcggatgatcgcgtcattgggttctacacgtcccccaatctcaaggaatggacg
cacgcctccaacttcacccagtcaggtttgccaggaacgcaattcgaatgccccaacctc
gtcaagttttcagtcgacgactgcgacgactcagaggaccccaccaagtgggtgctcttc
atttccgtcaaccctggagcgccactcgggggctcgggaacctactatgtcgttggaagc
ttcaatggaacccatttcacttcggaaagcccccgcgagaccctctatgacttcgccaag
gacaactacgcctctcagtggtactctggcatccccgaggacgagcccccggtctccatc
ggctgggccagcaactggaactacacccagcaggtgcccaccggccccctcgaaggctgg
agaagctccatgtcgctgcccaaagtgcacaccctgaccaaggtcgacggctcctgggtc
gtcaccaaagaaccattcgacggattggactccgtccgcgggaagcaactcaagggtaag
cgctcacggaacggcgatgtgacctttgacttcaaaaacgtcaaatccaatgctgtcgcc
ttcgacgtcaagatcaacgggatcccctcatctggcgcaacgggccaggtctacttcaac
ttcacctcgtcgacgtcgggcgagtacgtcgatggcggtctccgattggacaacggcttc
ttctggatcaaccgtgcgggaacccatctgttcactcaggccaacagcaccggctactgg
cccgtcttcaacacgaccgtcaagtcctacgaccaccacaagttcaccttctccggtgtc
attgatcgctccctgctcgaggtcaccctcgccgagggtgttcaaactggcacaatgagt
ttctacccaacccatccgctggataccctgaccgtgtccggcagcgatctgagcaagaag
acttctttccgtgctaaggcctggggcttggagagcggctggtag

DBGET integrated database retrieval system