KEGG   Aspergillus fumigatus: AFUA_2G04240Help
Entry
AFUA_2G04240      CDS       T01017                                 

Definition
(RefSeq) maleylacetoacetate isomerase MaiA
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
afm  Aspergillus fumigatus
Pathway
afm00350  Tyrosine metabolism
afm01100  Metabolic pathways
Module
afm_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AFUA_2G04240
Enzymes [BR:afm01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     AFUA_2G04240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 3507124
NCBI-ProteinID: XP_749556
UniProt: Q4WHT7
Position
2
AA seq 231 aa AA seqDB search
MEDSTSPKVTLYTYFRSSCSARLRIALNLKSIPYTPIAVNLLKGEQSSPENIALNPSGTV
PTLIVEHDSKEPVTITQSLAALEYLEEITPASSHALLPPASNPEARAVVRTLVDIMSCDV
QPVTNLRILKRVAPFGVDRAAWSKDLIEDGFRAYEAIAAKSAGLFSVGDSITMADVCLLP
AVWGAERAGVKVEKFPTIYRVAQRLEEEDAVKRAHWRTQPDTPEEFRVSSS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaagactcaacaagccccaaagtcaccctatacacctatttccgctcctcctgctca
gccagactccgcatcgccctcaacctcaaatccatcccttacaccccaatagccgtcaac
ctcctcaaaggcgagcaatcctccccagaaaatatcgcgctcaatccttccggtacagtc
cccaccctgatagtggaacacgactccaaagaacccgtgaccatcacgcagtccctcgca
gcactcgagtacctcgaagaaatcaccccagcctcatcccacgctctcctcccaccagct
tccaaccccgaggcccgcgcagtcgtccgcaccttggtagacatcatgtcctgcgatgtc
cagcctgtgactaatctccggattctgaagcgggtggcgccattcggcgtggaccgggcg
gcgtggtcgaaggatctgattgaggatggcttccgcgcgtacgaggccatcgcggcgaag
agtgcggggcttttcagcgtgggtgatagcattaccatggcggatgtgtgcctgcttcct
gcggtgtggggtgctgagagggcgggggtgaaggtggagaagtttcctacgatctaccgg
gttgcacagcgattagaggaggaagatgcggtgaagagggcgcattggaggacgcagcct
gatacgccggaggagtttcgagtgagttcttcttga

DBGET integrated database retrieval system