KEGG   Aspergillus fumigatus: AFUA_2G05800
Entry
AFUA_2G05800      CDS       T01017                                 

Definition
(RefSeq) IdgA domain protein
  KO
K16330  pseudouridylate synthase / pseudouridine kinase [EC:4.2.1.70 2.7.1.83]
Organism
afm  Aspergillus fumigatus
Pathway
afm00240  Pyrimidine metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AFUA_2G05800
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.83  pseudouridine kinase
     AFUA_2G05800
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.70  pseudouridylate synthase
     AFUA_2G05800
SSDB
Motif
Pfam: Indigoidine_A PfkB
Other DBs
NCBI-GeneID: 3507070
NCBI-ProteinID: XP_749709
UniProt: Q4WHD4
Position
2
AA seq 768 aa
MLSQAATRLCCRVRGPAIRAPRAIRSYHDVAQSKFLKVSEEIRDAVATGKPVVALESTIY
THGFPYPENVALASLLESVVRVNGGIPATIGILNGVARVGLSAEELTELASTAEKKDALK
VSRRDLGYICGLGMAGRRLHGGTTVSGTMVLAHLAGIKVFGTGGLGGVHRGGESSMDISA
DLTELGRTPVAVVSSGCKSFLDIPRTLEFLETEGVCVGTFADGREGSVDFPAFFSRDSGI
KSPRVIRDEAEAAAIIYAQSKLPVSSGIHFANPVPAEQSIPKGEMDIIIEEAIRLAEVEG
HRGSDNTPFVLAKIKELSGGKSVIANRALVEANVKRATKVAVELSKLEQADRGTGGRIEQ
LGKADVLVAGSLAIDLSCDYTPFASESDKITPVPQTSNPAVIGQSLGGVGHNVAIASHYL
GSSVLFCSVVGDDLSGRAALSTLQEEGLPTAGVQILPASSGARTAQYVAINDAKRDLVVA
MADMGIMELPEHVLDFDGFWDPLIRHTQPQWVVVDANWSPAVLARWIAVAKQHGARVAFE
PVSTAKSRRLFSKTSEADAVIQPAKAVPNNAISLAAPNQYELSAMYTTARESGLFEESEG
WWRIIDAMGMSATGSRDRLVAMTTAELVDQGIPQQSIQLIPFIPCIITKLGAQGVLVTQL
LRPGDARLTSPDSAPYILSRASPTDELIGGVYMRLFPSAGVLADREIVSVNGAGDTLLGA
VVAGLAKWSGKSVEEVIPLAQEASLRTLKSPGGVSRDLVTLRSLMAAL
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgctttcacaagccgctacccgactctgctgcagagttcggggaccagcaataagagct
cctcgggcaattcgaagctatcacgatgtcgcacaaagcaaattcttgaaagtatcagag
gaaattcgtgatgcggtggccacaggaaagccagtagtagcactggagtctacaatctat
acccacggctttccatatcccgagaatgtcgctctcgcctctttgcttgaatctgttgtt
cgggtcaatggtggaattcccgccacaatcggcattctcaatggggttgctagggttggc
ctcagtgctgaggagctcactgagctagcatcgaccgcggagaaaaaggatgccttgaag
gtttcccgtagagatctcggttatatatgcggcctgggaatggctgggagacgactccat
ggaggaacaactgtttcaggaacaatggtgcttgctcacttggctggtattaaggtgttc
gggacaggtggtctcggtggtgtccaccgtggaggggagtcgtccatggatatctctgcc
gatttgactgagctgggacggacacctgttgctgtcgtcagttccggatgcaagagcttc
ctggatatcccgcggacacttgaatttctagaaaccgagggagtctgtgtcgggacattt
gccgatggccgtgaaggctcagtggatttccctgcctttttctcgcgcgacagtggcatc
aagagccccagagtaatccgagatgaagcggaagcagctgcgatcatatacgcgcagtca
aagcttcctgtaagctctggtatccattttgccaatccagtgccagcggaacagtcgatc
cccaaaggcgaaatggacataataatagaagaggcgatccgtttggccgaagtcgagggt
caccgaggaagcgacaacacgcctttcgtacttgcaaaaataaaggaacttagtggcgga
aagagtgtgattgccaacagggcgctggtcgaggccaacgtgaagcgcgcaaccaaggtg
gcagttgaactctccaaactagaacaggctgatagggggactggaggccgcattgaacag
ctgggtaaggctgatgtccttgttgctggctctcttgcgatcgacctgtcctgcgattat
accccatttgctagcgagagtgacaagatcacacccgttcctcaaacatcgaaccccgcg
gtcatcgggcagagcctgggcggagtaggccacaacgttgccattgcgtcacattatctt
ggaagctctgttctgttctgcagtgtagtcggggatgacttgagtggccgcgctgcgctc
tcgactctccaggaagaaggactccccaccgccggcgtacagatcctgcctgcgtcgtcc
ggagcgcgcacggcacaatatgtcgccatcaacgacgcaaagcgcgacctcgtagtggct
atggctgacatgggcatcatggagctgccggagcacgtgcttgattttgacgggttctgg
gatcccctgatccgccacacccagccgcagtgggtggttgtggatgcgaattggagccca
gcggttctagccagatggattgccgttgctaaacagcacggtgcgcgggtggcctttgag
ccggtctcgacggccaagtctcgccgtcttttctccaagacctccgaggcggatgcagta
attcaaccggccaaggcagtccccaacaacgccatcagtctggccgctcccaaccagtac
gagctctcagccatgtacacgacagcccgcgaatcagggctcttcgaggagtccgaaggc
tggtggcgcatcatcgacgccatgggcatgtccgcgactggctcgcgagatcgtctcgtt
gcaatgaccacggccgagctggtggaccagggaatcccacagcagagcatccaactaatt
ccctttattccgtgcatcatcacgaaattgggcgctcagggggttctggtgacccaactg
ctccgtccgggagatgctcgtctcacatctcctgattcggcgccttacatcctctcgcgc
gcctcgcctacagatgagctaatcgggggggtgtatatgcgtcttttcccgtcagccggg
gtcctggcggatcgggagattgtgagcgtcaacggtgcgggggacacgttactgggcgcg
gttgttgcggggcttgcaaaatggtcagggaaatcggtcgaggaggtcattcctctggcg
caggaggctagtctgaggacgttgaagagtccaggtggtgtgagcagggatcttgttact
ctgcgatcattgatggctgccttataa

DBGET integrated database retrieval system