KEGG   Aspergillus fumigatus: AFUA_2G07630
Entry
AFUA_2G07630      CDS       T01017                                 

Definition
(RefSeq) vacuolar H+\/Ca2+ exchanger
  KO
K07300  Ca2+:H+ antiporter
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:afm02000]
    AFUA_2G07630
Transporters [BR:afm02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   AFUA_2G07630
SSDB
Motif
Pfam: Na_Ca_ex UPF0220
Other DBs
NCBI-GeneID: 3513081
NCBI-ProteinID: XP_755098
UniProt: Q4X255
Position
2
AA seq 471 aa
MGANTKYSFQNERVQQDGNTGDLRPGHFQPAGSPQGEPMLPTHNEKSARRYGIFRVDTAG
ESGRSGFHPVHFFAVCFKSTCTLSMLVNILWPFVPAAIAIHFARKDLHIWIFALNYVAMV
PSANLLGFAGGELARKLPKVLGILLETTLSSVVEIVLFMVLIHNDRGGNLIPVIQAAILG
SILANLLLCLGLCFFFGGIRRHEQSFHEAISEVGSGLLLVAGFGLLIPSAFYAALSSSST
KAIITPEDLDHSTLVISRSTSVILLVAFIMFLFYNLHSHHSIFDEVLEKDEQRDEDREEE
LQRTKLTLTECLVAIAFSLTFVCMSAVFLVEEIEYIVETGVSDNFMGLILVPLVEKAAEH
LTAIDEAWDNQINFALFHCLGPSIQTALLNAPLAVIVGWCLDKDMGLNFEIFMIVLVVLS
ILVVGNFLRDGKSNYLEGGLCVLVYVIIAVTTWYYPKVEGELGGHSGHPTE
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgggcgccaatacgaaatactcatttcagaatgaacgggtacagcaagacggaaatacc
ggggacctgaggccggggcatttccaaccagcagggtcaccgcagggtgagcccatgctt
cctacgcataacgagaagagtgctcgccgctatggaatattccgagtagacaccgctggc
gagagtggccgcagtgggtttcatcctgtccactttttcgcggtctgcttcaaaagcacc
tgtacactttcgatgctggtgaacatcctttggcctttcgtcccggccgctattgccata
cacttcgctcggaaggatcttcacatttggattttcgctttgaactatgttgccatggtc
ccttcagcaaacttgctcggctttgcaggcggcgagttggcaaggaagctgcccaaggtt
cttggaatactattggaaacaacactgagttctgtcgtggagatcgtactcttcatggtt
ttgatccacaatgatagagggggaaacctgatccctgtcatccaggccgctatcctgggc
tcaattcttgcgaatttgttgctttgcttggggttgtgcttcttcttcggaggtatcaga
cgccatgaacagtcgtttcatgaagctatcagtgaggtcgggtcggggcttctgctcgtt
gcaggttttggtctgttaataccgagcgctttctacgcggccctaagctcgagctcaacc
aaagcgatcatcactccagaagatttggatcactccactttggtaatcagtcgatctacc
tctgttattcttctcgtcgccttcattatgttcctgttctataatctgcatagtcatcat
agtatttttgatgaagtccttgagaaggacgagcagcgggacgaggatcgagaggaagaa
ttgcaacgcaccaagctcactctgaccgaatgtctagtggctatagcattttcgctcacg
ttcgtatgcatgtcagcagtctttttggtggaagaaatagagtacattgttgaaacaggg
gtttctgataactttatgggtctgatcttggttcctctagtcgagaaagcagcagagcat
ctgacagctattgacgaagcctgggacaatcaaatcaatttcgcactcttccactgcctc
ggcccttcaattcagacagctttgttgaacgcgccactggcagtcattgtgggctggtgc
cttgataaagacatgggtctcaacttcgaaatctttatgatcgtcctcgtcgtcctgtca
atcttggtggttggaaacttcttgcgcgatggaaagtccaattaccttgagggaggtctc
tgcgtgcttgtgtatgtcattattgctgttacaacttggtactatcccaaggtggaagga
gagttgggcggccactcgggccatcctaccgaataa

DBGET integrated database retrieval system